Potential for ginkgo biloba as a functional food

Potential for ginkgo biloba as a functional food

Potential for ginkgo biloba as a functional food

... efficiency Ginkgo has antibacterial, antifungal and antiviral qualities that are able to deal with a range of disorders, diseases and allergies, including asthma, hay fever, and Candida infections Enables ... pharmacology Trolox equivalent antioxidant capacity trimethylsilyl Total radical-trapping parameter assay -PE AAPH ABAP ABTS AEAC AH AOC CE CFs CP205 CYPs DPPH EGb 761 FL FRAP GAs GC...

Ngày tải lên: 17/09/2015, 17:19

226 183 0
Báo cáo khoa học: A novel plant protein disulfide isomerase family homologous to animal P5 – molecular cloning and characterization as a functional protein for folding of soybean seed-storage proteins docx

Báo cáo khoa học: A novel plant protein disulfide isomerase family homologous to animal P5 – molecular cloning and characterization as a functional protein for folding of soybean seed-storage proteins docx

... TGTAAAG TGTAAAG + ) + )95 )1100 )1470 ACACacG ACACttG ACACaaG + + + + ) ) ) ) ) )140 )1100 )1596 )1632 )140 )1100 )1596 )1632 )1874 CAaaTG CAagTG CAaaTG CAaaTG CAaaTG CActTG CAttTG CAgtTG TGAGTCA ... The Authors Journal compilation ª 2007 FEBS 407 Soybean protein disulfide isomerase family H Wadahama et al plant tissues using an RNeasy Plant Mini kit Quantification of mRNA was p...

Ngày tải lên: 30/03/2014, 04:20

12 348 0
Biological properties and the nutrition value of an Isochrysis strain as a live food for geo-duck larvae

Biological properties and the nutrition value of an Isochrysis strain as a live food for geo-duck larvae

... medium for strain was f/2 The Isochrysis galbana strain showed a huge range of fatty acids among, contained remarkable amount of PUFA and considerate level of EPA and DHA which play an essential ... report [12] DHA and EPA play an important role in the membrane lipids 3.4 Application of Isochrysis galbana H5 for feeding geo-duck at Vandon, Quangninh Iso...

Ngày tải lên: 13/08/2015, 00:34

5 405 0
Tài liệu Using Proven Sales Techniques for Selling WorkKeys as a Solution to Business doc

Tài liệu Using Proven Sales Techniques for Selling WorkKeys as a Solution to Business doc

... 2% of sales are made on the first contact 3% of sales are made on the second contact 5% of sales are made on the third contact 10% of sales are made on the fourth contact 80% of sales are made ... friendly manner, graciously and courteously •  That you want to help them •  To see you as the solution to their problem, and not be seen as your problem •  To be treated as...

Ngày tải lên: 19/02/2014, 14:20

48 482 0
Báo cáo khoa học: "Giant breast tumors: Surgical management of phyllodes tumors, potential for reconstructive surgery and a review of literature" potx

Báo cáo khoa học: "Giant breast tumors: Surgical management of phyllodes tumors, potential for reconstructive surgery and a review of literature" potx

... cystosarcoma phyllodes was also conducted Case presentation Case Patient A is a 64 year old white female who presented with a large right breast mass The mass had been present for at least years, and ... patient A was for the epithelial component and 13 for the stromal component Case 2: D) Large, branching ducts were surrounded by a uniform, bland stroma; areas of hy...

Ngày tải lên: 09/08/2014, 07:22

8 276 0
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx

Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx

... LQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFTWTS LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL LQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHLTSLLGLVAVALTWTL LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL ... LWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSVHSRNFVSFRVREALRVAHTHHANHALPVYVF...

Ngày tải lên: 13/08/2014, 09:21

11 247 0
evaluate potential use of gut weed (enteromorpha sp.) as a food source for tilapia (oreochromis niloticus): affect on survival and growth

evaluate potential use of gut weed (enteromorpha sp.) as a food source for tilapia (oreochromis niloticus): affect on survival and growth

... CAN THO UNIVERSITY COLLEGE OF AQUACULTURE AND FISHERIES EVALUATE POTENTIAL USE OF GUT WEED (Enteromorpha sp.) AS A FOOD SOURCE FOR TILAPIA (Oreochromis niloticus): AFFECT ON SURVIVAL AND GROWTH ... quarters of world Tilapia production were Nile Tilapia Production of Tilapia in Vietnam has been increasing year by year; the farming are...

Ngày tải lên: 18/11/2015, 19:54

44 243 0
Báo cáo khoa học: The human pyridoxal kinase, a plausible target for ginkgotoxin from Ginkgo biloba docx

Báo cáo khoa học: The human pyridoxal kinase, a plausible target for ginkgotoxin from Ginkgo biloba docx

... alkaline phosphase (Merck, Darmstadt, Germany; 100 U) at 37°C, as analyzed by HPLC Influence of ginkgotoxin on human pyridoxal kinase This material is available as part of the online article from ... methylpyridoxine in Ginkgo biloba leaves, Ginkgo medications and Japanese Ginkgo food Planta Med 62, 548–551 Scott PM, Lau BP, Lawrence GA & Lewis DA (2000) Analysis of Ginkgo...

Ngày tải lên: 07/03/2014, 10:20

10 530 0
Báo cáo khoa học: Distribution of the extrinsic proteins as a potential marker for the evolution of photosynthetic oxygen-evolving photosystem II ppt

Báo cáo khoa học: Distribution of the extrinsic proteins as a potential marker for the evolution of photosynthetic oxygen-evolving photosystem II ppt

... Chloroplast DNA Bacillariophyceae (diatoms) Thalassiosira pseudonana Nuclear DNA Chloroplast DNA Odontella sinensis Chloroplast DNA Prasinophyceae Mesostigma viride Chloroplast DNA Euglenophyceae ... glaucophyte, C paradoxa that has the most primitive plastids [23], contained the PsbV and PsbU proteins as the extrinsic proteins (Figs and 2) A primitive red alga, C caldarium th...

Ngày tải lên: 23/03/2014, 15:21

11 503 0
Báo cáo khoa học: "A PROLOG IMPLEMENTATION OF LEXICAL LANGUAGE FUNCTIONAL PROCESSING GRAMMAR SYSTEM AS A BASE FOR A NATURAL" pdf

Báo cáo khoa học: "A PROLOG IMPLEMENTATION OF LEXICAL LANGUAGE FUNCTIONAL PROCESSING GRAMMAR SYSTEM AS A BASE FOR A NATURAL" pdf

... relations of a sentence But what about the logical relations? Recall that each clause has a unique head end that the functional features of each phrase are identified with those of its head For ... property that the functional features of each phrase are identified with those of its head The head category of a phrase is characterized by d~e assignment of the trivial...

Ngày tải lên: 24/03/2014, 05:21

6 476 0
báo cáo hóa học: " Beyond platinum: synthesis, characterization, and in vitro toxicity of Cu(II)-releasing polymer nanoparticles for potential use as a drug delivery vector" ppt

báo cáo hóa học: " Beyond platinum: synthesis, characterization, and in vitro toxicity of Cu(II)-releasing polymer nanoparticles for potential use as a drug delivery vector" ppt

... the rate of Cu release (see Discussion) In vitro toxicity of CuCNPs in HeLa cells The in vitro toxicity of CuCNPs in HeLa cells (a cervical adenocarcinoma) was investigated via an assay based ... platinum: synthesis, characterization, and in vitro toxicity of Cu(II)-releasing polymer nanoparticles for potential use as a drug delivery...

Ngày tải lên: 21/06/2014, 02:20

10 495 0
Báo cáo lâm nghiệp: "old hardiness as a factor for assessing the potential distribution of the Japanese pine sawyer Monochamus alternatus (Coleoptera: Cerambycidae) in China" pdf

Báo cáo lâm nghiệp: "old hardiness as a factor for assessing the potential distribution of the Japanese pine sawyer Monochamus alternatus (Coleoptera: Cerambycidae) in China" pdf

... determining the geographical range of the beetle Meteorological data showed that local minimum temperature generally decreased with increasing latitude in eastern China (Climatic Atlas of the People’s ... a basis for predicting its potential distribution and dispersal, based on its cold hardiness, and to further evaluate the risks of transmission of the pine wil...

Ngày tải lên: 07/08/2014, 16:20

8 343 0
Báo cáo y học: "The potential of human regulatory T cells generated ex vivo as a treatment for lupus and other chronic inflammatory diseases" pot

Báo cáo y học: "The potential of human regulatory T cells generated ex vivo as a treatment for lupus and other chronic inflammatory diseases" pot

... Mason D: Evidence that the T cell repertoire of normal rats contains cells with the potential to cause diabetes Characterization of the CD4+ T cell subset that inhibits this autoimmune potential ... disease or certain forms of multiple sclerosis The adoptive transfer of regulatory T cells generated ex vivo also has the potential to prevent the rejection of al...

Ngày tải lên: 09/08/2014, 03:24

6 409 0
Báo cáo y học: "Local adherent technique for transplanting mesenchymal stem cells as a potential treatment of cartilage defect" pdf

Báo cáo y học: "Local adherent technique for transplanting mesenchymal stem cells as a potential treatment of cartilage defect" pdf

... were harvested during total Table Histological scoring system for cartilage repair Category Points Cell morphology Hyaline cartilage Mostly hyaline cartilage Mostly fibrocartilage Mostly non -cartilage ... necessary, thereby increasing the safety and economic feasibility Our study will advance and extend the clinical application of MSC-based cell therapy for cartilage injury Ma...

Ngày tải lên: 09/08/2014, 10:23

10 470 0
Báo cáo y học: " Promoting functional foods as acceptable alternatives to doping: potential for informationbased social marketing approach" pptx

Báo cáo y học: " Promoting functional foods as acceptable alternatives to doping: potential for informationbased social marketing approach" pptx

... was not formally assessed Study design In order to gain insight into the most widely known performance enhancing supplements and healthy foods, male patrons of a local gymnasium were asked to ... Promoting functional foods as acceptable alternatives to doping: potential for information-based social marketing approach Journal of the International Society of Sports...

Ngày tải lên: 11/08/2014, 23:21

11 290 0
w