Inducible targeted tagging system for localized insertional mutagenesis in arabidopsis thaliana

... INDUCIBLE- TARGETED TAGGING SYSTEM FOR LOCALIZED INSERTIONAL MUTAGENESIS IN ARABIDOPSIS THALIANA BINDU NISHAL (B.Sc., M.Sc.) A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR ... describes a system of inducible insertional mutagenesis based on the Ac-Ds family of transposons for targeted tagging in Arabidopsis thaliana In this system, the Ac and Ds elem...

Ngày tải lên: 16/09/2015, 15:55

... are indicated in lower case Overlapping sequences found in deletion sites are highlighted in bold Inserted sequence is highlighted in bold and Italic - 28 - Table Classification of mutations induced ... Local Lesions in Genomes (TILLING) [5-9] Because of its mutation-inducing property, EMS is also very useful for producing leaky alleles in forward genetics By contrast, X-rays...

Ngày tải lên: 11/08/2014, 11:21

... Conclusions We have described a new efficient statistical speech act type tagging system based on a statistical model used in Japanese morphological analyzers This system integrates linguistic, acoustic, ... features and efficiently performs optimal segmentation of a turn and tagging From several tagging experiments, we showed that the system segmented turns and assign...

Ngày tải lên: 31/03/2014, 04:20

... adopted to treat a typical village sewage There is the long rain season in local place always accompanied with strong storms at the beginning The stormwater runoff not only brings the large amounts ... or float method RESULTS AND DISCUSSION Removal performance of constructed wetland system for village sewage The COD Profiles of influent and effluent, as well as corre...

Ngày tải lên: 05/09/2013, 08:40

... (1985) Fuzzy hierarchical analysis Fuzzy Sets Systems, 17(1), 233–247 Buckley, J J (1985) Ranking alternatives using fuzzy numbers Fuzzy Sets Systems, 15(1), 21–31 Byun, D (2001) The AHP approach for ... world textile and clothing industry The Turkish clothing industry is the fourth largest supplier in the world, and the second largest supplier in the EU The Turkish...

Ngày tải lên: 07/12/2013, 11:41

... Ishihara et al (Eur J Biochem 270) Here we examined the effects of SA on stress response in mammalian cells using a simple screening system, and revealed that SA is a potent Hsp inducer in mammalian ... expression of endogenous heat shock proteins such as Hsp1 0 5a and Hsp7 0 in various mammalian cells Enhancement of thermoresistance of cells...

Ngày tải lên: 17/03/2014, 10:20

... both domains contain a large number of English inclusions, their type-token ratio amounts to 0.29 in the internet data and 0.15 in the space travel data (Table 1), signalling that English inclusions ... tokenisation and POStagging as well as a lexicon lookup and Google lookup module for identifying English inclusions 4.1 Pre-processing Module In the pre-processing module,...

Ngày tải lên: 23/03/2014, 19:20

... integrated battery for transport The membrane oxygenator (PLS-QuadroxD, Maquet-Cardiopulmonary-AG) is made of polymethylpentene, which avoids plasma-leakage and has a total gas exchange surface ... the use of a new miniaturized system for extracorporeal membrane oxygenation in a large adult study population with severe ARDS Crucial Table Frequency of complications...

Ngày tải lên: 13/08/2014, 20:21

... but also provides information about how RNA helicase acts as a negative regulator in K+ deprivation signaling pathways in Arabidopsis However, the precise mechanism of the regulation between AtHELPS ... whether DExH box RNA helicases are involved in plant responses to abiotic stresses remain to be addressed In this study, we identified and characterized an Arabidop...

Ngày tải lên: 14/02/2014, 18:20

... identification and simulation A mathematical model was developed, representing central carbohydrate metabolism in leaves of A thaliana The model was based on the following system of ordinary differential ... in A thaliana A D B E C F Fig Maximum activities of enzymes in central carbohydrate metabolism during cold exposure (A C) Vmax values of three invertase...

Ngày tải lên: 14/02/2014, 22:20

... -LDGHNEG-VTMAGYGYGIPISRLYAR IKMSDRGGGVPLRRIERLFSYMYSTAPTPQPGTGG -TPLAGFGYGLPISRLYAK IKISDRGGGVSRTILDRLFTYMYSTAPPPPRDGTQPP -LAGYGYGLPLSRLYAR IK+SD GGG+ R+ L RIFTY+YSTA P +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP ... YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLGDSEEPLP YFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHHYQTIQEAGDWCVPSTE YFHGDMYLVSMEGYGTDAMIFLKAI...

Ngày tải lên: 31/03/2014, 15:20

... ptCpn60α and ptCpn60β are required for proper FtsZ ring formation To confirm the reduction of ptCpn60β proteins in ptcpn60β mutants and further examine localization of the proteins, we prepared ... thaliana proteins with cyanobacterial chaperonin 60 proteins (Figure 2) Of these, two proteins, including At2g28000, were grouped as ptCpn60α (we named them ptCpn60α1 and pt...

Ngày tải lên: 12/08/2014, 03:20

... to distinguish the individual roles of these DnaJ proteins in co-chaperone/chaperone cohort Nevertheless, in general, these small chloroplast DnaJ proteins participate in optimization of CO2 ... specific band was missing from the respective DnaJ mutant This indicates that chloroplasts are at least one of the compartments containing these small DnaJ proteins...

Ngày tải lên: 12/08/2014, 03:21

... (5'GGGGACAAGTTTGTACAAAAAAGCAGGCTTCAACAA TGGCGGCGGATGCTCTGAG3' and 5'GGGGACCACTTTGTACAAGAAAGCTGGGTCAGCAGCAACTTCTTCTTGAT CCTTG3') The expression clone was inserted into the donor vector pDONR201, and subsequently transformed ... through PCR amplification with the primer LBa-1 (located on the TDNA insert: 5'TGGTTCACGTAGTGGGCCATCG3') and primers flanking the predicted inserts (5'AAAAACAAAAGCAGACA...

Ngày tải lên: 12/08/2014, 05:20

... metabolism, and to reveal functions of "orphan" P450 enzymes An extensive and sustained annotation of the P450 genes in sequenced organisms, including plants, is being carried out and has been ... during plant development or roles in plant defense, and signaling networks These may guide further investigation into the function of individual members of this large gene family, in...

Ngày tải lên: 12/08/2014, 05:20