the identification and characterization of genes with potential roles in fetal ovary development

... Biochem. 270) 3905 The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data ... core description and the spectroscopic and redox properties of each identified heme from the NrfHA complex. Conclusions D. desu...

Ngày tải lên: 21/02/2014, 00:20

... ricin, in particular its route into target cells and the fate of its two subunits, RTA and the cell-binding galactose-specific lectin ricin toxin B chain (RTB), are essential to gain further insights ... were CP172 5Â-ATATTCCCCAAACAATACCC-3Â and the anti- sense primer CP133 5Â-TTAAAACTGTGACGATGGT GGA-3Â with the TAA termination anticodon shown in bold. Amplification reactions w...

Ngày tải lên: 23/03/2014, 07:20

... biochemically close to that of the bacteria. Keywords: thioredoxin; thioredoxin reductase; hyper- thermophile; aerobic archaea; Aeropyrum pernix. The thioredoxin system composed of thioredoxin (Trx), thioredoxin ... activity was measured using the glutathione-disulfide transhydro- genase assay described by Gan et al.[25]. Thioredoxin reductase activity assays Assays for thio...

Ngày tải lên: 23/03/2014, 21:20

... GTGTTCGACTTTGCCAGCCTGTACCCCAGCATCATCCAGGCCCACAACCTGTGC VZV GTATTGGATTTTGCAAGTTTATATCCAAGTATAATTCAGGCCCATAACTTATGT HHV6 GTGTTTGATTTTCAAAGTTTGTATCCGAGCATTATGATGGCGCATAATCTGTGT CMV GTGTTCGACTTTGCCAGCCTCTACCCTTCCATCATCATGGCCCACAACCTCTGC ... GTAGTAGACTTTGCTAGCCTGTATCCTAGTATTATACAAGCTCATAATCTATGC EHV2 GTGGTGGACTTTGCCAGCCTGTACCCCACCATCATCCAGGCCCACAACCTCTGC MHV68 GTAGTGGACTTTGCCAGCCTGTACCCA...

Ngày tải lên: 18/06/2014, 22:20

... D, Atkins L, Kato DT, Buczek-Thomas J, Fuller AF Jr, Hasan T: Characterization of a xenograft model of human ovarian carcinoma which produces intraperitoneal carcinomatosis and metastases in ... significance of stathmin expression in correlation with metastasis and clinicopathological characteristics in human ovarian carcinoma. Acta Histochemica 2008, 110:59-65. 37....

Ngày tải lên: 20/06/2014, 07:20

... al.: Identification and characterization of alkaline serine protease from goat skin surface metagenome. AMB Express 2011 1:3. Submit your manuscript to a journal and benefi t from: 7 Convenient ... ORIGINAL ARTICLE Open Access Identification and characterization of alkaline serine protease from goat skin surface metagenome Paul Lavanya Pushpam,...

Ngày tải lên: 21/06/2014, 05:20

... Wireless Communications and Networking Volume 2006, Article ID 93712, Pages 1–12 DOI 10.1155/WCN/2006/93712 Modeling and Characterization of VCOs with MOS Varactors for RF Transceivers Pedram ... VCO architectures, LC VCOs have superior phase noise performance and therefore are extensively used in RF transceivers. Varactors are the main tuning component of LC...

Ngày tải lên: 22/06/2014, 22:20

... experiments and participated in the design of the study and analysis of the data. FC participated in the design of the study and in the anal- ysis of data and helped to draft the manuscript. PM cloned and sequenced ... and revision of the study. AS partic- ipated in the analysis and interpretation of data and helped to draft the manuscri...

Ngày tải lên: 09/08/2014, 08:22

... (f) An area of an OA synovium demonstrates a lining layer completely devoid of c19orf10 staining. (g) Intense staining of a hyperplastic RA synovial lin- ing cell layer. This staining was typical ... Expression of c19orf10 in OA synovium. (a) Intense staining of the synovial lining layer and perivascular regions of RA (OCT sec- tion) tissue.(b) Intense staining of t...

Ngày tải lên: 09/08/2014, 10:20

... 2 011 , 11 :14 4 http://www.biomedcentral.com /14 71- 2229 /11 /14 4 Page 12 of 17 clearly demonstr ated the presence of HA-CaNDR1a pro- teins in tobacco PM fractions. Therefore, it is likely that the ... number of the Nicotiana tabacum Hin1 coding sequence is GenBank: AB0 914 29 .1. Cacas et al. BMC Plant Biology 2 011 , 11 :14 4 http://www.biomedcentral.com /14 71- 2229...

Ngày tải lên: 11/08/2014, 11:21

... à3XNHNRKHGZDUIả /HDI 6HSDO 6 HSDORLGSHWDO 3HWDO 3LVWLO %UDFW 6WDPHQ 3, /HDI 6HSDO 6 HSDORLGSHWDO 3HWDO 3LVWLO %UDFW 6WDPHQ Figure 5 Expression profiles of Actinidia flowering genes in norma l and aberrant flowers. R eal-time RT-PCR analysis of the Actinidia flowering genes in the leaf and floral organs of A. deliciosa ... 11:72 http://www.biomedcentral.com/1471-2229/11/7...

Ngày tải lên: 11/08/2014, 11:22

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...

Ngày tải lên: 14/08/2014, 16:21

Ngày tải lên: 14/11/2014, 06:20

Ngày tải lên: 14/11/2014, 13:05