some local-global non-vanishing results for theta lifts from orthogonal groups

A study on communicative activities in english reading classes for the 10th from students

A study on communicative activities in english reading classes for the 10th from students

... and some types of Communicative Activities in language classes. In addition, the definition of reading, the importance of reading, the principles for teaching reading and types of reading activities ... The rest part, AFTER YOU READ, includes some activities for consolidation. After finishing the reading tasks in while reading, teacher can ask students...
Ngày tải lên : 18/12/2013, 10:03
61 821 12
Tài liệu Praise for Marketing Insights from A to Z pdf

Tài liệu Praise for Marketing Insights from A to Z pdf

... bullet, that delivers the advantage. A great company will have incorporated a set of advantages that all reinforce each other around a basic idea. Wal-Mart, IKEA, and South- west Airlines have unique ... convenient way. ã Managers who may have taken a course on marketing some years ago and have realized things have changed. You may want to refresh your understanding of marketing...
Ngày tải lên : 20/01/2014, 01:20
226 1.2K 0
Tài liệu The Cost of a Military Person-Year - A Method for Computing Savings from Force Reductions pptx

Tài liệu The Cost of a Military Person-Year - A Method for Computing Savings from Force Reductions pptx

... federal agencies. We also analyze the fairly crude estimates of the cost of a military person-year that result from the application of these data. We then present the official DoD costs of military ... to the actual cost of a person-year than previous estimates and that they are therefore better estimates of the actual sav- ings the federal governm...
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport...
Ngày tải lên : 18/02/2014, 08:20
14 617 0
Tài liệu Thermodynamic Models for Industrial Applications: From Classical and Advanced Mixing Rules to Association Theories pptx

Tài liệu Thermodynamic Models for Industrial Applications: From Classical and Advanced Mixing Rules to Association Theories pptx

... Cataloging-in-Publication Data Kontogeorgis, Georgios M. Thermodynamic models for industrial applications : from classical and advanced mixing rules to association theories / Georgios M. Kontogeorgis, Georgios ... ionic strength www.it-ebooks.info Thermodynamic Models for Industrial Applications From Classical and Advanced Mixing Rules to Asso...
Ngày tải lên : 18/02/2014, 15:20
727 1.2K 0
Báo cáo sinh học: " Some results for the q-Bernoulli, q-Euler numbers and polynomials" ppt

Báo cáo sinh học: " Some results for the q-Bernoulli, q-Euler numbers and polynomials" ppt

... using the definitions of ζ q (s, x) and ζ q ,E (s, x), we can define the q-analogues of Dirichlet’s L-function. Some results for the q-Bernoulli, q-Euler numbers and polynomials Daeyeoul Kim 1 and ... q-Bernoulli, q-Euler numbers and polynomials related to the Bosonic and the Fermionic p-adic integral on Z p In this section, we provide some basic formula...
Ngày tải lên : 18/06/2014, 22:20
17 369 0
báo cáo hóa học:" Some results for the q-Bernoulli, q-Euler numbers and polynomials" ppt

báo cáo hóa học:" Some results for the q-Bernoulli, q-Euler numbers and polynomials" ppt

... q)  , [x] k q = 1 2  k  i=0  k i  q i E i (x, q) + E k (x, q)  Some results for the q-Bernoulli, q-Euler numbers and polynomials Daeyeoul Kim 1 and Min-Soo Kim ∗2 1 National Institute for Mathematical Sciences, Doryong-dong, ... corresponds to the article as it appeared upon acceptance. Fully formatted PDF and full text (HTML) versions will be made available soo...
Ngày tải lên : 20/06/2014, 04:20
17 423 0
Báo cáo toán học: " Some results for the q-Bernoulli, q-Euler numbers and polynomials" doc

Báo cáo toán học: " Some results for the q-Bernoulli, q-Euler numbers and polynomials" doc

... q-Bernoulli, q-Euler numbers, and polynomials. 2. q-Bernoulli, q-Euler numbers and polynomials related to the Bosonic and the Fermionic p-adic integral on ℤ p In this section, we provide some basic formulas ... functions of the q-Bernoulli, q-Eule r numbers, and polynomials. We shall provide some basic formulas for the q-Bernoulli and q- Euler polynomials...
Ngày tải lên : 20/06/2014, 21:20
16 442 0
Báo cáo hóa học: " Some fixed point-type results for a class of extended cyclic self-mappings with a more general contractive condition" pdf

Báo cáo hóa học: " Some fixed point-type results for a class of extended cyclic self-mappings with a more general contractive condition" pdf

... Open Access Some fixed point-type results for a class of extended cyclic self-mappings with a more general contractive condition M De la Sen 1* and Ravi P Agarwal 2 * Correspondence: manuel. delasen@ehu.es 1 Instituto ... a class of extended cyclic self- mappings with a more general contractive condition. Fixed Point Theory and Application...
Ngày tải lên : 20/06/2014, 22:20
14 418 0
báo cáo hóa học: " Some new results for BVPs of first-order nonlinear integro-differential equations of volterra type" doc

báo cáo hóa học: " Some new results for BVPs of first-order nonlinear integro-differential equations of volterra type" doc

... Cambridge, New York, Melbourne (1978) doi:10.1186/1687-1847-2011-14 Cite this article as: Xing and Fu: Some new results for BVPs of first-order nonlinear integro-differential equations of volterra ... Difference Equations 2011, 2011:14 http://www.advancesindifferenceequations.com/content/2011/1/14 Page 14 of 17 RESEARCH Open Access Some new results for...
Ngày tải lên : 21/06/2014, 02:20
17 381 0
Báo cáo hóa học: " Research Article Some Results for a Finite Family of Uniformly L-Lipschitzian Mappings in Banach Spaces" pdf

Báo cáo hóa học: " Research Article Some Results for a Finite Family of Uniformly L-Lipschitzian Mappings in Banach Spaces" pdf

... 2007, Article ID 58494, 8 pages doi:10.1155/2007/58494 Research Article Some Results for a Finite Family of Uniformly L-Lipschitzian Mappings in Banach Spaces Shih-Sen Chang, Jia Lin Huang, and ... L-Lipschitzian mappings in stead of the assumption that T is a uniformly L-Lipschitzian and asymptotically pseudocon- tractive mapping in a Banach...
Ngày tải lên : 22/06/2014, 19:20
8 236 0
Báo cáo hóa học: " NOTE ON SOME RESULTS FOR ASYMPTOTICALLY PSEUDOCONTRACTIVE MAPPINGS AND ASYMPTOTICALLY NONEXPANSIVE MAPPINGS" pptx

Báo cáo hóa học: " NOTE ON SOME RESULTS FOR ASYMPTOTICALLY PSEUDOCONTRACTIVE MAPPINGS AND ASYMPTOTICALLY NONEXPANSIVE MAPPINGS" pptx

... γ n  1+a n  1+k n  T n y n − u n  . (2.6) NOTE ON SOME RESULTS FOR ASYMPTOTICALLY PSEUDOCONTRACTIVE MAPPINGS AND ASYMPTOTICALLY NONEXPANSIVE MAPPINGS YUCHAO TANG AND LIWEI LIU Received 26 May 2006; ... discuss convergence theorems of modified Ishikawa and Mann itera- tive sequences with errors for asymptotically pseudocontractive and asymptotically...
Ngày tải lên : 22/06/2014, 22:20
7 164 0
Từ khóa: