reservoir base fracture optimization approach

... Conclusion Finite time exergoeconomic performance of an irreversible universal steady flow heat pump cycle model with variable-temperature heat reservoirs, and the losses of heat transfer and internal ... All rights reserved. Finite time exergoeconomic performance optimization for an irreversible universal steady flow variable-temperatur...

Ngày tải lên: 05/09/2013, 15:28

... Arnold Jung and Ying Shi. 2010. LCC Approaches to Knowledge Base Population at TAC 2010. Proc. TAC 2010 Workshop. Paul McNamee and Hoa Dang. 2009. Overview of the TAC 2009 Knowledge Base Population ... rela- tionships, and employment relationships. 7 Toward System Combination The increasing number of diverse approaches based on different resources provide new opportu- ni...

Ngày tải lên: 20/02/2014, 04:20

... NSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA 53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ 63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEK 73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD motif- TEQGGGGAGGSNSSGS...

Ngày tải lên: 20/06/2014, 01:20

... shoulder with dislocation of the acromioclavicular joint and fracture of base of coracoid process. Figure 2 Axial CT image of the right shoulder with an intact epiphyseal plate of the coracoid process. Figure ... seen in children. A coraco id fracture can be isolated or associated with an injury complex, including any of acromiclavicular disruption, cla...

Ngày tải lên: 20/06/2014, 04:20

... [1-3]. Acromioclavicular joint dislocation is a very rare injury in a child below the age of thirteen [4]. We report an interesting case of fracture of the coracoid process associated with acromioclavicular joint ... 30:1597-1599. 9. Lasda NA, Murray DG: Fracture separation of the coracoid process associated with acromioclavicular dislocation: Conservati...

Ngày tải lên: 20/06/2014, 07:20

... Article A General Iterative Approach to Variational Inequality Problems and Optimization Problems Jong Soo Jung Department of Mathematics, Dong -A University, Busan 604-714, Republic of Korea Correspondence ... Theory and Applications Feasibility and Optimization and Their Applications (Haifa, 2000), vol. 8 of Studies in Computational Mathematics, pp. 473–...

Ngày tải lên: 21/06/2014, 11:20

... and the genotype can describe the number of base stations as well as the position of the base station, (ii) a chromosome expresses one base station position, (iii) the number of possible base station ... using fewer base stations. Therefore, the purpose of optimization in this paper is to determine the maximum traffic coverage with the minimum number...

Ngày tải lên: 21/06/2014, 22:20

... this collaboration, several observations may be made: 1) The Grid concepts and tools provide a workable alternative that enables collaboration across traditional institutional boundaries without ... (termination condition = false) gen = gen + 1; apply genetic operators to Pop(gen) evaluate fitness of the population end A Service-Oriented Approach for Aerodynamic Sh...

Ngày tải lên: 27/06/2014, 17:20

... investigate furthermore the parametric affine variational in- equality approach to linear fractional vector optimization problems, which can help to obtain tight upper estimates for the number of ... Mathematics 33:4 (2005) 477–489 On the Parametric Affine Variational Inequality Approach to Linear Fractional Vector Optimization Problems T. N. Hoa, T....

Ngày tải lên: 06/08/2014, 05:20

... 10Effect of Filler Incorporation on the Fracture Toughness Properties 4. CONCLUSION The general behaviour of the tested materials showed that the dry samples provided higher values of fracture ... 6Effect of Filler Incorporation on the Fracture Toughness Properties Figure 1: Effect of filler content on...

Ngày tải lên: 07/08/2014, 14:20

... basic motif finding case above, employing the same LP formulation and DEE techniques. Subtle motifs Another widely studied formulation of motif finding is the 'subtle' motifs formulation ... Central Page 1 of 13 (page number not for citation purposes) Algorithms for Molecular Biology Open Access Research A combinatorial optimization approach for diverse motif...

Ngày tải lên: 12/08/2014, 17:20

... 3 Research Severe hyperlactatemia with normal base excess: a quantitative analysis using conventional and Stewart approaches Graciela Tuhay, Mar a Carolina Pein, Fabio Daniel Masevicius, Daniela ... acquisition of data, and contributed to the analysis and interpretation of data. AD drafted the manuscript and performed the statistical analysis. All authors rea...

Ngày tải lên: 13/08/2014, 11:22

... shows a fracture profile as a function of all the fracture lengths for which the model has been run. Once the fracture dimensions are known as well as how the actual reservoir impacts fracture ... the fracture is designed so that the proppant reaches the tip of the fracture at the time the fracture reaches the desired length. When the proppant reaches the tip of the fra...

Ngày tải lên: 04/10/2014, 22:10

... multistage fractures in unconventional reservoirs. Further, it means that in general, anything that can be done to increase the conductivity of the fracture should yield a corresponding increase in ... using combinations of sliding sleeve and plug and perf methodology [Rankin, 2010]. In fact, it is rumored that some are contemplating as many as 50 stages in the future....

Ngày tải lên: 04/10/2014, 22:11

... nt Colony O p tim iza tion 20 3.1 The Ant Algorithms 20 3.1.1 Double bridge experim ents 20 3.1.2 Ant S y ste m 22 3.1.3 Ant Colony S y stem 24 3.1.4 Max-Min Ant System 25 3.2 Ant Colony Optimization ... Vietnam National University, Hanoi College of Technology Huy Quang Dinh An Ant Colony Optim ization Approach for Phylogenetic Tree Reconstruction Problem...

Ngày tải lên: 25/03/2015, 09:38