Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...

Ngày tải lên: 14/08/2014, 16:21

... bio- chemical knowledge is Pathway Tools, a software environ- ment for curation, analysis, and visualization of integrated genomic and pathway data [4,10]. The PathoLogic compo- nent of Pathway Tools ... views of the mouse metabolome, specific pathways, and the details of individual genes and pro- teins allows a systems-based approach for the analysis and int...

Ngày tải lên: 09/08/2014, 20:20

... both affordable arrays and array data is essential for the Drosophila community. A limited number of aliquots of the FlyGEM primers have been made available to regional, national and international ... list has been extensively annotated and linked-out to other databases. Incyte and the NIH have made the platform available to the community via academic microarray faci...

Ngày tải lên: 09/08/2014, 20:21

... tomography/computed tomography in the staging and evaluation of treatment response in a patient with Castleman's disease: a case report Ettore Pelosi* 1 , Andrea Skanjeti †2 , Angelina Cistaro †1 ... in a patient with a mediastinal mass. Then, other authors reported new cases of the disease with different localisations, including abdominal and superficial lymph node...

Ngày tải lên: 11/08/2014, 23:21

... In the report of Papanikolaou and colleagues, we under stand that patients developed fi stulas before VAC applications and not as a result of their use. In cases like these, the optimal treatment ... by nurses and physicians can reduce this critical problem, and during VAC use in particular, a correct sponge appli ca- tion and effi cient planning of vacuum use managed...

Ngày tải lên: 13/08/2014, 20:21

... P Kervarec, B Augé, L Brault, Ch Piroth, F Pascaud, and N Gerard. Acknowledgements The authors thank Ouarda Pereira and Marie-Line Erpelding for their assistance in statistical analysis. The research ... K, Martin-Mola E, Nielsen H, Silman A, Smolen J, Yazici H: EULAR recommendations for the management of early arthritis: report of a task force of the European Standi...

Ngày tải lên: 09/08/2014, 14:22

... because of the compu- tational inefficiency for training over massive datasets [41]. Efficiency and scalability are key challenges for handling massive datasets in a boosting paradigm [42]. The ... straightforward static sampling over such a large dataset may result in a significant loss of infor- mation and a potentially biased classifier. A standard boost- ing algo...

Ngày tải lên: 14/08/2014, 17:22

... already scheduled for coronary angiography for any indication and had no history of a coronary revascularization procedure prior to the scheduled angiography. Forty-four patients had a history ... 260 and economic evaluation, of myocardial perfusion scintigraphy for the diagnosis and management of angina and myocardial infarction. Health Technol Assess. 2004;...

Ngày tải lên: 08/08/2014, 16:23

... Harris RA, et al. The role of coronary angiography and coronary revascularization before noncardiac vascular surgery. JAMA. 1995; 273: 1919-1925. 8. Scanlon PJ, Faxon DP, Audet AM, et al. ACC/AHA ... Metcalfe M. Systematic review of the effectiveness and cost-effectiveness, and economic evaluation, of myocardial perfusion scintigraphy for the diagnosis and management...

Ngày tải lên: 08/08/2014, 17:20

... Hematology, University of Perugia, Perugia, Italy). The forward and backward primers were: 5’-CGGGATCCATCGAAGGTCGTGAAGATTCGAT GGACAT-3’, and 5’-CGCGCGACCGAGCGGAA GCTTCTATTTTCTTAAAGAGAC-3’. Underlined ... protein. The purified protein was dialysed against phosphate-buffered saline (PBS) overnight at 4°C and stored at -80°C before analyzed by SDS-PAGE and quantitated by usin...

Ngày tải lên: 08/08/2014, 18:21