Báo cáo y học: "Metagenomics for studying unculturable microorganisms: cutting the Gordian knot" doc
... finally cut the massive knot and called the act his greatest victory. One strategy to expose the rest of the microbial world to the eye of the microbiologist - analogous to attempting to untie the ... that they did not iden- tify any 16S rRNA gene fragments from any phyla with no cultured representatives. A further limitation of this study was presented by Delong [12], who point...
Ngày tải lên: 14/08/2014, 14:21
... reliably and relatively easily determined; and (3) ascertaining that there is a close relationship between the marker and the outcome or characteristic of interest. In systemic lupus erythematosus ... apply them. The review of the literature was done by traditional methods: searching by key words and search engines, scouring the reference lists and doing deeper-level searches, and r...
Ngày tải lên: 09/08/2014, 01:23
... this year, Retrovirology will recog- nize annually through the Retrovirology Prize one 45- to 60- year-old retrovirologist. The selection process This editorial kicks-off the 2005 call for nominations ... argu- ably the most productive denizens of science are those in the 45 to 60 age group (who are no longer young investi- gators and not yet competitive for lifetime achievement...
Ngày tải lên: 13/08/2014, 09:21
Báo cáo y học: "Prohormones for prediction of adverse medical outcome in community-acquired pneumonia and lower respiratory tract infections"
... responsible for the biomarker measurements in a blinded way. The statistical analyses were performed by MW and PS. PS and MW take full respon- sibility for the reported results. PS, MW and BM drafted the ... prognostic accuracy. Both risk scores were validated for the predic- tion of mortality only. Their ability to predict other important adverse disease outcomes including t...
Ngày tải lên: 25/10/2012, 10:02
Báo cáo y học: " Rationale for one stage exchange of infected hip replacement using uncemented implants and antibiotic impregnated bone graft"
... culturing the sonication fluid is likely to raise sensitivity of cultures significantly. Especially in patients having received antimicrobial therapy within 14 days before culture the sensitivities ... and the activity remains far beyond the susceptibility of relevant pathogens for several weeks. These capacities make them more attractive for local therapy and allow us- ing...
Ngày tải lên: 26/10/2012, 09:53
Báo cáo y học: "Foundation for the Community Control of Hereditary Diseases, Budapest, Hungary"
... epicanthal folds, ocular hypotelorism, preauricular tags and pits, low-set ears, simian crease, clino- and camptodactyly, partial syndactyly between toes 2 and 3, hydrocele, umbilical hernia, ... pregnancies. Thus we used the term birth (live- and stillbirths) prevalence in the past. However, recently the different methods of prenatal diagnoses have been used widely for the...
Ngày tải lên: 02/11/2012, 11:12
Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot
... licheniformis 78–95 TSQA DVGYGAYDLYDLGE P06278 Bacterium Paenibacillus polymyxa 812–830 KSE YAYHGYHTYDFYAVDG P21543 Bacterium Escherichia coli 255–285 IHGWVGGGTKGDFPHYAYHGYYTQDWTNLDA P25718 G4-forming ... Other binding residues (W9 AMY2 , H92 AMY2 , T94 AMY2 , A95 AMY2 , Y1 30 AMY2 , A145 AMY2 , F180 AMY2 , K182 AMY2 , W206 AMY2 , S208 AMY2 , Y2 11 AMY2 , H288 AMY2 , Q294 AMY2 , M296 AMY2 a...
Ngày tải lên: 31/03/2014, 08:20
Báo cáo Y học: Evidence for general stabilization of mRNAs in response to UV light pdf
... stability of mRNAs expressed using the tet-off system which allows the termination of only the synthesis of the mRNA under study. This enabled us to also investigate transcripts with comparatively long ... inhibition of their transcription by the tetracycline analog doxycycline. The b-globin mRNA exhibits a long half-life under these conditions (> 10 h [16], and additional data,...
Ngày tải lên: 31/03/2014, 08:20
Báo cáo y học: "Fishing for Allergens: Bloodworm-Induced Asthma" doc
... breath and skin rash when feeding the fish. The patient keeps no pets at home, and although there is no personal history of atopy, her father has hay fever. The physical exam- ination was unremarkable ... workplace, a research laboratory that studies fish biology. On a recent holiday, her symptoms completely resolved, but they recurred within a week of her returning to work. The patie...
Ngày tải lên: 08/08/2014, 20:23
Báo cáo y học: "Validation and test-retest reliability of the Royal Free Interview for Spiritual and Religious Beliefs when adapted to a Greek population" doc
... from the community on the basis of their availability. They received a brief explanation of the purpose and the aim of the study, and those who agreed to participate were asked to sign an informed ... experience. For these four persons, the mean effect of this experience on their lives was moderate (4.69 ± 2.9). The majority of persons participating in our study answered that...
Ngày tải lên: 08/08/2014, 21:20