Báo cáo y học: " Identification of co-regulated transcripts affecting male body size in Drosophila" docx

Báo cáo y học: " Identification of co-regulated transcripts affecting male body size in Drosophila" docx

Báo cáo y học: " Identification of co-regulated transcripts affecting male body size in Drosophila" docx

... loci are involved with the formation of body size in a natural population. Of these loci, only InR is directly correlated with body size. Given our lim- ited knowledge of pathways for body size, ... significantly on any factor were distributed among the three clusters. Candidate loci for body size We again queried FlyBase for a list of genes involved in body size...

Ngày tải lên: 14/08/2014, 14:21

15 190 0
Báo cáo y học: " Identification of novel transcripts with differential dorso-ventral expression in Xenopus gastrula using serial analysis of gene expression" pptx

Báo cáo y học: " Identification of novel transcripts with differential dorso-ventral expression in Xenopus gastrula using serial analysis of gene expression" pptx

... Importantly, 86 tags of those expressed differ- entially correspond to novel transcripts. Regulation of expression by -catenin of novel transcripts identified by SAGE Many of the genes involved in ... been typically used as a model organism to study early embryonic development, particularly dorso-ventral patterning. In order to identify novel transcripts involved in dorso...

Ngày tải lên: 14/08/2014, 21:20

16 332 0
Báo cáo y học: "Identification of citrullinated α-enolase as a candidate autoantigen in rheumatoid arthritis" doc

Báo cáo y học: "Identification of citrullinated α-enolase as a candidate autoantigen in rheumatoid arthritis" doc

... our cell lysates were extensively deiminated in vitro. This is demonstrated by the uniform migration of deiminated enolase at a pI of 5 and by the replacement of arginine by citrulline in all the ... citrullinated proteins by the anti-modified citrulline kit was mainly confined to the subsynovium. (b) No staining was visible on the control. (c) Staining produced by the anti-α-enola...

Ngày tải lên: 09/08/2014, 07:20

9 397 0
Báo cáo y học: " Identification of a novel linear B-cell epitope in the UL26 and UL26.5 proteins of Duck Enteritis Virus" doc

Báo cáo y học: " Identification of a novel linear B-cell epitope in the UL26 and UL26.5 proteins of Duck Enteritis Virus" doc

... DQDEPDA DYPYYPGE ARGA PRGVDS GRDEPDR DFPYYPGE ARPE PRPVDS DYDDRD DAPYYPGE ARAP PRVVPDSGGRGR DHDDRD DAAYYPGE ARAP RFAPDSAG R DRSIESD LYYPGE FRRSNFSPPQASSMKYEET DKSPEQE PYYPGE FQQS EHRNLRCEDG DKYDEPD ... to be 520 IYYPGE 525 , because any deletion of residues from either end of 520 IYYPGE 525 destroyed the ability of mAb 1C8 to bin d. Comparative analysis of the amino acid sequences...

Ngày tải lên: 12/08/2014, 01:21

9 450 0
Báo cáo y học: "Mechanism of the chromosome-induced polar body extrusion in mouse eggs" potx

Báo cáo y học: "Mechanism of the chromosome-induced polar body extrusion in mouse eggs" potx

... chromosomes induce cortical actin and myosin II assembly into a distinct actincapsurroundedbyamyosinIIringintheMII eggs [6]. Interestingly, sperm chromatin incorporation at fertilization or m icroinjection ... protrusion, most likely by activating myosin II contractility [16]. Consistently, inhibition of myosin II contraction by using bl ebbistatin [17] or myo sin light chain kinase by ML-7...

Ngày tải lên: 13/08/2014, 18:21

9 302 0
Báo cáo y học: "Identification of novel Y chromosome encoded transcripts by testis transcriptome analysis of mice with deletions of the Y chromosome long arm" potx

Báo cáo y học: "Identification of novel Y chromosome encoded transcripts by testis transcriptome analysis of mice with deletions of the Y chromosome long arm" potx

... *********** ECTSFFPIVSHTYHYVIQLYNCNHFDQHSQEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFMCKLLPVLCYFPPDDSF1 ... Sry Sxr a 7 copies Rbmy Sry Zfy2 Uty Eif2s 3y Smcy Ube 1y Zfy1 Usp 9y Dby XSxr Y *xa XY Del 2/3 MSYq Del Sry Del 9/10 MSYq qdel XY RIII XY XY RIII Large X...

Ngày tải lên: 14/08/2014, 15:20

15 252 0
Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx

Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx

... and in the GenePaint database, we analyzed the in situ hybridization staining pattern in the pan- creas from TS22 whole embryo sections. In sum, 601 of the genes showed informative staining, ... TS22 pancreas staining patterns of 601 genes in the GenePaint database [27,28], providing insight into the expression profiles of hundreds of transcripts previ- ously not described...

Ngày tải lên: 14/08/2014, 20:22

19 441 0
Báo cáo y học: "Identification of clinical and simple laboratory variables predicting responsible gastrointestinal lesions in patients with iron deficiency anemia"

Báo cáo y học: "Identification of clinical and simple laboratory variables predicting responsible gastrointestinal lesions in patients with iron deficiency anemia"

... up- per/lower endoscopy in outpatients with iron defi- ciency anemia. The aim of our study was to investi- gate the incidence of GI pathological findings in symptomatic and asymptomatic patients ... cause of IDA in developing countries is still nutri- tional deficiency. In some instances, an insufficient supply of iron may contribute to the development of iron deficiency...

Ngày tải lên: 25/10/2012, 11:18

9 425 1
Báo cáo y học: "Identification of Cellular Membrane Proteins Interacting with Hepatitis B Surface Antigen using Yeast Split-Ubiquitin System"

Báo cáo y học: "Identification of Cellular Membrane Proteins Interacting with Hepatitis B Surface Antigen using Yeast Split-Ubiquitin System"

... vivo detection of interactions of proteins, enables identification of protein- protein interactions between a soluble bait and its interacting prey [5]. However, such a screening system is not ... interacting proteins. 3. Results and Discussion 3.1 Principle of Split-Ubiquitin Screening System Studies have shown that the use of yeast two hybrid system, which is a genetic as...

Ngày tải lên: 02/11/2012, 11:08

4 494 0
Báo cáo y học: "Identification of subpopulations with characteristics of mesenchymal progenitor cells from human osteoarthritic cartilage using triple staining for cell surface markers" docx

Báo cáo y học: "Identification of subpopulations with characteristics of mesenchymal progenitor cells from human osteoarthritic cartilage using triple staining for cell surface markers" docx

... markers within the channel display. The distinction to negative assessed cells is presented in Fig. 1 by showing an exem- plary FITC-isotype antibody mIgG 1 staining. Comparing total quantities of triple ... no difference between isotype and antibody staining. A maximum of 2% positive cells by staining with isotype anti- body mouse IG1 or IG2 conjugated with FITC, PE or biotin was al...

Ngày tải lên: 09/08/2014, 01:23

11 346 0
Từ khóa:
w