Báo cáo y học: "Genome-wide mutagenesis of Zea mays L using RescueMu transposons" ppsx

Báo cáo y học: "Genome-wide mutagenesis of Zea mays L. using RescueMu transposons" ppsx

Báo cáo y học: "Genome-wide mutagenesis of Zea mays L. using RescueMu transposons" ppsx

... hypermethylated [12,13]. With- out selection for somatic instability of a visible reporter allele and/or hypo-methylation, Mutator lines inevitably lose Mu element mobility. The high efficiency of ... transposa- ble element Mu-1 accompanies loss of gene expression. EMBO J 1985, 4:869-876. 35. Levy AA, Walbot V: Molecular analysis of the loss of somatic instability in the bz2::mu1 al...

Ngày tải lên: 14/08/2014, 14:21

20 136 0
Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt

Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt

... +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLGDSEEPLP YFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHHYQTIQEAGDWCVPSTE YFHGDMYLVSMEGYGTDAMIFLKAIPVEASEVLPIYSTSSRRQLTMSPQAADWSHQLPNH ... IKISDEGGGIPRSGLSRIFTYLYSTAENPPD LDGHNEG-VTMAGYGYGIPISRLYAR IKMSDRGGGVPLRRIERLFSYMYSTAPTPQPGTGG TPLAGFGYGLPISRLYAK IKISDRGGGVSRTILDRLFTYMYSTAPPPPRDGTQPP LAGYGYGL...

Ngày tải lên: 31/03/2014, 15:20

6 368 0
Báo cáo y học: "Genomewide characterization of non-polyadenylated RNA" doc

Báo cáo y học: "Genomewide characterization of non-polyadenylated RNA" doc

... be ( a ) ubr4 12 12 12 12 pA+ pA- pA+ pA- HeLa H9 nup155 16 16 16 16 pA+ pA- pA+ pA- H9 HeLa Bimorphic ( b ) znf207 15 15 15 15 pA+ pA- pA+ pA- HeLa H9 Genes HeLa UBR4 WDFY3 NUP155 SFRS18 PDK4 ZKSCAN EIF3A ZRANB1 SF3B2 PHKB ZNF217 H9 Y Y Y Y - Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Chr 1 4 5 6 7 7 10 10 11 16 20 Bimorphic pA+ Y Y Y - Y Y - - - Y Y - - - Y - - Y Y...

Ngày tải lên: 09/08/2014, 22:23

14 374 0
Báo cáo y học: "Association Study of Aromatase Gene (CYP19A1) in Essential Hypertension" ppsx

Báo cáo y học: "Association Study of Aromatase Gene (CYP19A1) in Essential Hypertension" ppsx

... [17]. Linkage disequilibrium (LD) analysis and haplotype-based case-control analysis LD analysis and haplotype-based case-control analysis were performed with SNPAlyze version 3.2.3 (Dynacom ... None of the controls had a family history of hypertension, and they all had SBP and DBP below 130 and 85 mmHg, respectively. A family history of hypertension was defined as prior diagnosi...

Ngày tải lên: 08/08/2014, 16:23

7 378 0
Báo cáo y học: "Differential expression of RANK, RANK-L, and osteoprotegerin by synovial fluid neutrophils from patients with rheumatoid arthritis and by healthy human blood neutrophils" doc

Báo cáo y học: "Differential expression of RANK, RANK-L, and osteoprotegerin by synovial fluid neutrophils from patients with rheumatoid arthritis and by healthy human blood neutrophils" doc

... 2002, 100:3646-3655. 19. Lacey DL, Timms E, Tan HL, Kelley MJ, Dunstan CR, Burgess T, Elliott R, Colombero A, Elliott G, Scully S, et al.: Osteoprotegerin ligand is a cytokine that regulates osteoclast differentiation and ... two- tailed p value of less than 0.05. Results Expression of RANK -L, OPG, RANK, and TRAF6 mRNAs by SF neutrophils from patients with RA and by healthy human blood...

Ngày tải lên: 09/08/2014, 10:20

12 477 0
Báo cáo y học: "Widespread remodeling of mid-coding sequence nucleosomes by Isw" ppsx

Báo cáo y học: "Widespread remodeling of mid-coding sequence nucleosomes by Isw" ppsx

... regulation of chromatin structure, which could partially rely on Isw1. Notably, deletion of ISW1 resulted also in significantly shorter inter-nucleosomal linker regions, or even loss of linkers, ... Jaspersen SL, Kobor MS, Shilatifard A: Linking cell cycle to histone modifications: SBF and H2B monoubiquitination machinery and cell-cycle regulation of H3K79 dimethylation. Mol Cell 20...

Ngày tải lên: 09/08/2014, 20:22

13 191 0
Báo cáo y học: "Chemical injuries of the oesophagus: aetiopathological issues in Nigeria" ppsx

Báo cáo y học: "Chemical injuries of the oesophagus: aetiopathological issues in Nigeria" ppsx

... treatable by oesophageal substitu- tion. From the foregoing, it is clear that knowledge of the aetiology and pathology of chemical burns of the oesophagus will ultimately determine the applicable treatment ... leucocytes, sub epithelial leucocytes, basal cell hyperplasia and ulcers depending on the depth of mural involvement. In severe cases, wall perforation may lead to mediastinitis...

Ngày tải lên: 10/08/2014, 10:20

5 397 0
Báo cáo y học: "Clinical audit of core podiatry treatment in the NH" ppsx

Báo cáo y học: "Clinical audit of core podiatry treatment in the NH" ppsx

... AM: Mobility disability among elderly men and women in Sweden. International Disability Studies 1990, 12(1):1-5. 16. Campbell J: Modelling deterioration of foot health in older people following ... Collingwood J, Hull R, McDonald I, Parkinson L: Evaluating podiatry services: testing a treatment specific measure of health status. Quality Of Life Research: An International Journal Of...

Ngày tải lên: 10/08/2014, 21:23

6 431 0
Báo cáo y học: "Ocular pathology of uncommon hematologic malignancies: a case series" ppsx

Báo cáo y học: "Ocular pathology of uncommon hematologic malignancies: a case series" ppsx

... leukemia (CMML), a disease formerly classi- fied solely as a type of myelodysplastic syndrome (MDS) but reclassified in 1999 as a mixed MDS/myeloprolifera- tive disorder [8]. Myelodysplastic syndrome ... demonstrates infiltration of atypical cells within the vasculature of the choroid bilaterally as well as a subretinal hemorrhage with leukemic infiltration in the left eye. To our knowl...

Ngày tải lên: 11/08/2014, 10:23

4 241 0
w