Báo cáo y học: " Functions, structure, and read-through alternative splicing of feline APOBEC3 genes" ppt
Báo cáo y học: " Functions, structure, and read-through alternative splicing of feline APOBEC3 genes" ppt
... KVHPWARCHAEQCFLSWFRDQYPYRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS 120 A3Cb KVHPWARCHAEQCFLSWFRDQYPYRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS A3Cc KVHPWARCHAEQCFLSWFRDQYPCRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS A3Ca IFTSRLYYFWDPNYQEGLCKLWDAGVQLDIMSCDDFKHCWDNFVDHKGMRFQRRNLLKDY ... 5 Expression analysis of feline A3C, A3H and A3CH. (a,b) Analysis of expression of feline A3C, A3H and A3CH by R...
Ngày tải lên: 14/08/2014, 08:20
Báo cáo Y học: Chemical structure and immunoreactivity of the lipopolysaccharide of the deep rough mutant I-69 Rd–/b+ of Haemophilus influenzae docx
... aKdo-(2–4)-aKdo-(2–6)-bGlcN-4P-(1–6)-aGlcN-1P. The availability of both oligosaccharides as free ligands and as neoglycoconjugates now enables us to investigate further this antibody by NMR and crystallography. ACKNOWLEDGEMENTS We ... composed of the b isphosphorylated glucosamine b ackbone of lipid A a nd Kdo-4P, w hereby the latter determines t he specificity strictly by the positi...
Ngày tải lên: 31/03/2014, 21:21
Báo cáo y học: "Sleep structure and sleepiness in chronic fatigue syndrome with or without coexisting fibromyalgia" pdf
... sleep efficiency, affective symptoms and intensity of fatigue. Neuropsychobiology 2007, 56:40-46. 13. University of Medicine and Dentistry of New Jersey's Pain and Fatigue Study Center [http://www.umdnj.edu/fatigue ] 14. ... FitzGibbons 1 , Carmen Garcon 1 and David M Rapoport 4 1 Pain and Fatigue Study Center, Department of Neurosciences, University of Medicine an...
Ngày tải lên: 09/08/2014, 10:23
Báo cáo y học: " Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses" docx
... adults. Journal of Consulting and Clinical Psychology 2000, 68(5):748-766. 54. Sherif M: The psychology of social norms. New York, NY: Harper; 1936. 55. Asch SE: Social psychology. Englewood ... Child Psychology and Psychiatry 2011, 16(4):621-634. 40. Nomura Y, Chemtob CM: Effect of maternal psychopathology on behavioral problems in preschool children exposed to terrorism: Use...
Ngày tải lên: 11/08/2014, 16:21
Tài liệu Báo cáo Y học: Ligand interactions and protein conformational changes of phosphopyridoxyl-labeled Escherichia coli phosphoenol pyruvate carboxykinase determined by fluorescence spectroscopy pdf
... Chile; 2 Department of Microbiology and Immunology, University of Saskatchewan, Saskatoon, Canada Escherichia coli phosphoenolpyruvate (PEP) carboxykinase catalyzes the decarboxylation of oxaloacetate and transfer ... are colored yellow, and the C-terminal domains green. The phosphoryl and pyridoxyl moieties of the P-pyridoxyl group are shown in red and magenta, respectively...
Ngày tải lên: 21/02/2014, 01:21
Báo cáo Y học: Spectroscopic characterization and ligand-binding properties of chlorite dismutase from the chlorate respiring bacterial strain GR-1 ppt
... Electron spinresonancestudyoftheroleofnitricoxideandcatalaseinthe activation of guanylate cyclase by sodium azide and hydro- xylamine. Modulation of enzyme responses by heme proteins and their nitrosyl derivatives. ... 7.16 and rhombicity V/D ¼ 0.52), horseradish peroxidase (5.15 and 0.38), cytochrome c peroxidase (7.29 and 0.49), myoglobin (6.92 and 0.46), and hemoglobin (6...
Ngày tải lên: 08/03/2014, 16:20
Báo cáo y học: "Differential Constitutive and Cytokine-Modulated Expression of Human Toll-like Receptors in Primary Neutrophils, Monocytes, and Macrophages" docx
... control of TLR5 by inflammatory cytokines may contribute to regulation of innate immunity in monocytes and neu- trophils. The effects of G-CSF and M-CSF on TLR expres- sion in neutrophils and ... TLR2 and TLR4 in neutrophils and monocytes. GM-CSF up-regulated expression of TLR2 and TLR4 in neutrophils and TLR2 in monocytes. TLR5 was down-regulated by inflammatory cy...
Ngày tải lên: 08/08/2014, 16:23
Báo cáo y học: "Anti-tumorigenic and Pro-apoptotic effects of CKBM on gastric cancer growth in n" potx
... founding Editor and Editor-in-Chief of Biological Signals and Biological Signals and Receptors, Adjunct Professor of University of Toronto and is Honorary or Visiting Professor of over ten universities. ... Vice President and Chief Technology Officer of CK Life Sciences Limited. Dr. Pang was the Head of Department of Physiology at University of Hong Kong prior join...
Ngày tải lên: 08/08/2014, 18:20
Báo cáo y học: "Women, men, and rheumatoid arthritis: analyses of disease activity, disease characteristics, and treatments in the QUEST-RA Study" ppsx
... Farmacotherapy) study [64] of patients with early RA, erosive disease was present in 27% of men and 28% of women at the time of diagnosis. Similar percentages of females and males were free of any radiographic ... Tuulikki Sokka, Jyväskylä Central Hospital, Jyväskylä, Medcare Oy, Äänekoski, Finland; Hannu Kautiainen, Medcare Oy, Ääneko- ski, Finland; Theodore Pincus, New York...
Ngày tải lên: 09/08/2014, 01:22
Báo cáo y học: "Psychological stress and fibromyalgia: a review of the evidence suggesting a neuroendocrine link" pps
... overall symptoms and tender points [49]. Androgens Normal physiology and response to stress Dehydroepiandrosterone (DHEA) is the major androgen produced by the adrenal glands, both in women and men. Up ... central nervous system (CNS) metabolism of tryptophan (TRY) to 3- hydroxykynurenine (OHKY) in fibromyalgia syndrome (FS) [abstract]. Arthritis Rheum 1993, Suppl 9:222. 89. Risch SC,...
Ngày tải lên: 09/08/2014, 01:23