Báo cáo y học: "The human phylom" docx

... represented in the present phylome, namely primates (human, chimpanzee and macaque), artyodactyla (cow), carnivora (dog) and rodents (rat and mouse). While the monophily of artyodactyla and carnivores, ... 2003, 19:1572-1574. 22. Supplementary material [http://bioinfo.cipf.es/data/ human_ phylome /human_ phylome.html] 23. Keane TM, Creevey CJ, Pentony MM, Naughton TJ, McLnerney JO: Assessmen...

Ngày tải lên: 14/08/2014, 07:21

... Nucleosome fractionation by mercury affinity chromatography: contrasting distribution of transcrip- tionally active and acetylated histones in nucleosome fractions of wild-type yeast cells and cells ... suggest th at dynamic changes in the acetylation patterns, initiated by the recruitment of h istone acetyltransferase a nd deacetyltransferase to the LCR, may affect globin gene expression by re...

Ngày tải lên: 18/03/2014, 01:20

... group. Results ACZ885 is a human antibody that binds to human IL-1β with high affinity and neutralizes human IL-1β in vitro and in vivo ACZ885 was derived by subjecting genetically engineered mice carrying part ... affinity (about 40 pmol/l). No cross-reactivity toward rodent IL-1β or human IL-1α was observed for ACZ885. The antibody was found to neutralize the bioactivity of human...

Ngày tải lên: 09/08/2014, 10:23

... the relevance to human allergy needed to be established. The aim of the current study was to amplify the present knowledge of mesquite allergens which affect humans preliminary to investigating ... this study compare favorably to the cross-reactive mesquite allergens we pre- viously described [12] using mesquite-sensitized rabbits. While this does not necessarily mean that the human aller...

Ngày tải lên: 13/08/2014, 13:22

... Petsko http://genomebiology.com/2005/6/8/116 Genome Biology 2005, 6:116 hydrogen sulfide as a source of energy (electrons), in a process similar to anoxygenic photosynthesis.) Then there’s the ... The early history of life on earth therefore was probably largely governed by the need to adapt to reduced temperatures as the planet cooled, which required the evolution of better catalysts. Some ....

Ngày tải lên: 14/08/2014, 14:21

... abundance 664.91 b13 MS MS/MS b6 y8 y1 2 y4 y *++12 y+ +12 y9 b10 y1 0 b 0 6 y 0 ++12 b*5 b*4 y3 200 400 600 800 1000 1200 m/z Relative abundance MS/MS/MS b11 y4 y8 y1 0 y5 y9 b3 y1 1 y7 b9 b7 y6 b4 b2 (a) (b) (c) http://genomebiology.com/2006/7/9/R80 ... activity, acting on CH-OH group of donors Exopeptidase activity Hydrolase activity, hydrolyzing O-glycosyl compound...

Ngày tải lên: 14/08/2014, 17:22

... RD, Gobran LI, Rooney SA, Elias JA: Pulmonary type II cell hypertrophy and pulmonary lipoproteinosis are features of chronic IL-13 exposure. Am J Physiol Lung Cell Mol Physiol 2002, 283:L52-59. 35. ... cultured type II cells of adult human lung. Am J Physiol Lung Cell Mol Physiol 2010, 299:L36-50. 43. Ware LB, Fang X, Matthay MA: Protein C and thrombomodulin in human acute lung injury. Am...

Ngày tải lên: 12/08/2014, 11:23

... Virol 2001, 75:4420-3. 154. Miyazato P, Yasunaga J, Taniguchi Y, Koyanagi Y, Mitsuya H, Matsuoka M: De novo human T-cell leukemia virus type 1 infection of human lymphocytes in NOD-SCID, common gamma-chain knockout ... model with a functionally active human immune system to study human immunodeficiency virus type 1 infection. Clin Vaccine Immunol 2007, 14:391-6. 131. Van Duyne R, Ca...

Ngày tải lên: 12/08/2014, 23:22

... mortality in burn patients [14]. The Commentary Recombinant human activated protein C in acute lung injury: what is the role of bronchial circulation? Marc O Maybauer, Daniel L Traber and Dirk M Maybauer Department ... simultaneously in Pseudomonas aeruginosa-induced lung injury in rats [8], the oxygenation further deteriorated – beneficial effects could only be shown when rhAPC was given p...

Ngày tải lên: 13/08/2014, 11:23

... IRGQ1 (human) 343 H-Ras-1 (human) TIQERLSRYIQEFCLANGYLLP KNSFLKEIFYLKYYFL SLEDKLFKYIKHISSVTGGPV AAVTYYRMAYYLQNLFL SIIAQATSAAEAFCAVKGGPE SSAFQALKVYYRRTQFL SLGEKLLRYVEKFCSVSGGLI ATGVYFRKIFYLQNYFL ... KNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN KN-HCREILYLKLYFLDMVTEDAKTLLKEICLRN AVGLYFPAIYYLQLHILDTVTEDAKVLLRWKYSKPRSNSTYP AVGLYFRKTYYLQLHFLDTVTEDAKVLLRWKYSKPRSNSTYP AAGLYFRKTYYLQFHFLDTVAE...

Ngày tải lên: 14/08/2014, 15:20