Báo cáo y học: "Too cold may not be so cool: spontaneous hypothermia as a marker of poor " ppt

... instead of spontaneous hypothermia, as a result of hypothalamic damage [10].  is study may also help explain some recent clinical observations. In particular, it was recently shown that early ... Emergency Cardiovascular Care. Circulation 2005, 112(24 Suppl):IV1-203. doi:10.1186/cc9270 Cite this article as: Wörner J, Oddo M: Too cold may not be so cool: spontane...

Ngày tải lên: 13/08/2014, 21:21

... BED or (4) bulimia nervosa (BN). Psychiatric status was assessed through a chart review, medical doctor referee and psychiatrist interview. Data analyses Statistical analysis was performed by ... eating symptomatology may play an important role in the initi- ation and maintenance of the WG phenomenon observed in at least part of patients with schizophrenia. Finally, management of AP...

Ngày tải lên: 08/08/2014, 21:20

... suppression of HAV IRES- mediated transl ation by amantadine and IFN-alpha. Sup- pression effects at 48 h after transfection by the combina- tion of amantadine and IFN-alpha against HAV replication ... first study demonstrating that a combination of amantadine and IFN-alpha can suppress HAV replica- tion more effectively than amantadine or IFN-alpha alone. Abbreviations HAV: hepatitis...

Ngày tải lên: 12/08/2014, 01:21

... disease, ability to be trans- mitted by aerosol, and lack of a vaccine or therapeutic drug led to its classification as a National Institutes of Allergy and Infectious Diseases (NIAID) Category A pathogen ... resulting in large areas of monolayer breakdown (Figure 2C). Cellu- lar cytotoxicity was measured by MTT assays, and chro- mosomal DNA fragmentation analysis was employed...

Ngày tải lên: 12/08/2014, 01:22

... have also adopted this strategy as a way forward in molecular analysis. Alagaratnam et al are utilising Bayesian approaches to pursue muscular dystro- phy diagnosis [223]. Similarly, the example ... other arbitrary measures for disease classification. Adopting a systems biology approach, whereby a disease defining molecular fingerprint is analysed, would increase the accuracy of dis...

Ngày tải lên: 12/08/2014, 14:20

... the basis of capture by infliximab-coated microplates and detection by peroxidase-conjugated infliximab. This ass ay was standardised by the use of a mouse monoclo- nal antibody against human immunoglobulin ... concentration between baseline and week 18 (AUC 0-18 ). Clinical and laboratory evaluations were performed at each visit. The Bath Ankylosing Spondylitis Disease Activity Index (...

Ngày tải lên: 12/08/2014, 15:23

... [2]. Hyal2 is a member of a family of proteins, some of which exhibit high hyaluronidase activity and are capable of rapid degrada- tion of hyaluronan, a component of the extracellular matrix. ... LWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPTYSR 303 Human LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR 300 Mouse LWAESTALFPSVYLDETLASSVHSRNFVSFRVREAL...

Ngày tải lên: 13/08/2014, 09:21

... examined race as a potential confounder because of the recognized association between Black race and increased mortality and minor imbalances in race by HTLV status. Black race was significantly associated ... InfectionsHuman T-lymphotropic virus 2 Abstract Background: HTLV-I is associated with adult T-cell leukemia, and both HTLV-I and -II are associated with HTLV-associated myelopathy...

Ngày tải lên: 13/08/2014, 13:20

... Additionally, recent evidence sug- gests that sagittal balance may more closely correlate to symptoms than sagittal alignment [71] Cervical lordosis by itself may not provide an accurate assessment of ... classified as idiopathic [2], a minority of scoliosis cases are traced to structural anomalies [3], such as wedged vertebrae or abnormal soft tissue develop- ment. In additio...

Ngày tải lên: 13/08/2014, 14:20

... [36], as well as being an early marker of lung parenchyma remodeling [32,37]. We also measured the levels of mRNA expression of caspase-3, because it represents a surrogate parameter for the final ... Update for the Clinical Application of Echocardiography: summary article. A report of the American College of Cardiology/ American Heart Association Task Force on Practice...

Ngày tải lên: 13/08/2014, 20:22