Báo cáo y học: " Eicosapentaenoic acid preserves diaphragm force generation following endotoxin administration" docx
... EPA EPA Diaphragm Specific Force (N/cm 2 ) Frequency (Hz) Figure 1 Diaphragm force- frequency curves. Force generation was significantly lower at stimulation frequencies from 1 to 80 Hz for diaphragms ... carbobenzoxy-valyl-alanyl- aspartyl-[O-methyl]-fluoro-methylketone; PEG-SOD: polyethylene glycol superoxide dismutase; SDS: sodium dodecyl sulfate; SDS-PAGE: sodium dodecyl sulfa...
Ngày tải lên: 13/08/2014, 20:21
... by the ch ondrocytes. This hydrated matrix consists of proteoglycan aggregates, containing sulphated glycosaminoglycans (sGAG), which are entangled in a meshwork of collagen, predominantly type II. ... loss of key structural components such as sulphated glycosaminoglycan (sGAG) and collagen II. The aim of this study was to examine the therapeutic potential of n-3 polyunsaturated fatty acids (...
Ngày tải lên: 12/08/2014, 15:22
... Matsushima Y, Kobayashi Y, Yamamoto Y: Age estima- tion by measuring the racemization of aspartic acid from total amino acid content of several types of bone and rib cartilage: a preliminary account. ... were hydrolyzed into their individual amino acids by heating for 8 hours at 105°C, followed by rapid neutralization on ice with 6 N NaOH. The hydrolyzed samples were stored at -80°C un...
Ngày tải lên: 09/08/2014, 13:22
Báo cáo y học: "Uric acid is a strong independent predictor of renal dysfunction in patients with rheumatoid arthritis" docx
... Xia YY, Chen Q, Kang DH, Gordon KL, Watanabe S, Nakagawa T, Lan HY, Johnson RJ: Hyperuricemia induces a primary renal arteriolopathy in rats by a blood pressure-independent mechanism. Am J Physiol Renal ... a general Japanese population: the Hisayama study. Kidney Int 1999, 55:2450-2456. 63. Kato Y, Hayashi M, Ohno Y, Suzawa T, Sasaki T, Saruta T: Mild renal dysfunction is associated with i...
Ngày tải lên: 09/08/2014, 14:22
Báo cáo y học: "Retinoic acid induces HL-60 cell differentiation via the upregulation of miR-663" docx
... Han R, Yang M: Gene expression analysis of human promyelocytic leukemia HL-60 cell differentiation and cytotoxicity induced by natural and synthetic retinoics. Life Sci 2009, 84:576-583. 5. Yedjou ... Biochem Biophys Res Commun 2004, 322:403-410. 32. Lutherborrow M, Bryant A, Jayaswal V, Agapiou D, Palma C, Yang YH, Ma DD: Expression profiling of cytogenetically normal acute myeloid leukemia...
Ngày tải lên: 10/08/2014, 21:23
Báo cáo y học: "Amino acid substitutions in the E2 glycoprotein of Sindbis-like virus XJ-160 confer the ability to undergo heparan sulfate-dependent infection of mouse embryonic fibroblasts" docx
... crystal Zhu et al. Virology Journal 2010, 7:225 http://www.virologyj.com/content/7/1/225 Page 2 of 6 17. Zhu WY, Yang YL, Fu SH, Wang LH, Zhai YG, Tang Q, Liang GD: Substitutions of 169Lys and 173Thr in ... immunodefi- ciency virus type 1 (HIV-1) [11], adeno-associated virus type 2 (AAV2) [12], respiratory syncytial virus (RSV) [13], foot-and-mouth disease virus (FMDV) [14], a nd human papill...
Ngày tải lên: 12/08/2014, 01:21
Báo cáo y học: "Tranexamic acid attenuates inflammatory response in cardiopulmonary bypass surgery through blockade of fibrinolysis: a case control study followed by a randomized double-blind controlled trial" doc
... Horacek M, Vislocky I: A retrospective survey of fibrinolysis as an indicator of poor outcome after cardiopulmo- nary bypass and a possible early sign of systemic inflamma- tion syndrome. Eur J ... 11 No 6 Research Tranexamic acid attenuates inflammatory response in cardiopulmonary bypass surgery through blockade of fibrinolysis: a case control study followed by a randomized double-blind...
Ngày tải lên: 13/08/2014, 08:21
Báo cáo y học: " Valproic acid and HIV-1 latency: beyond the sound bite" ppsx
... Central yours — you keep the copyright Submit your manuscript here: http://www.biomedcentral.com/info/publishing_adv.asp BioMedcentral Retrovirology 2005, 2:56 http://www.retrovirology.com/content/2/1/56 Page ... intensification is necessary or especially beneficial. Theses data suggest that intensification may not be necessary or helpful, or more importantly, that reduction of the reservoir...
Ngày tải lên: 13/08/2014, 09:21
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx
... EFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQ 237 Mouse EFEFAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQ 237 Bee RFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQ PSAQCEATTMQENDK ... FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW 240 Mouse FAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW 240 Rat FAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWDSYTGRCPD...
Ngày tải lên: 13/08/2014, 09:21
Báo cáo y học: "Tranexamic acid in cardiac surgery: is there a cause for concern" pps
... voluntary withdrawal of aprotinin in certain markets has had two major eff ects. e fi rst was to cause all of the safety and effi cacy data for aprotinin to be independently examined by regulatory ... complex, typically combined valve and revascularisation surgery. e current article [1] mirrors a meta-analysis showing re- exploration for bleeding is reduced by aprotinin but not tranexam...
Ngày tải lên: 13/08/2014, 21:21