Báo cáo y học: " Analysis of novel geometry-independent method for dialysis access pressure-flow monitoring" pdf

Báo cáo y học: " Analysis of novel geometry-independent method for dialysis access pressure-flow monitoring" pdf

Báo cáo y học: " Analysis of novel geometry-independent method for dialysis access pressure-flow monitoring" pdf

... x-axis, thereby plotting the pressure drop along the length of the access longitudinally for a family of access flows Q. The Reynolds numbers >2300 for blood exiting the dialysis needles suggest ... 2005, 16(Suppl):S120-S127. 7. Roy-Chaudhury P, Kelly BS, Zhang J, Narayana A, et al.: Hemodialy- sis vascular access dysfunction: From pathophysiology to novel therapies. Bloo...

Ngày tải lên: 13/08/2014, 16:21

12 331 0
Báo cáo y học: ":Identification of novel stem cell markers using gap analysis of gene expression data" ppsx

Báo cáo y học: ":Identification of novel stem cell markers using gap analysis of gene expression data" ppsx

... murine embryonic development [43]. CYP1A2 is one of the major CYP1 enzymes that catalyze 2-hydroxylation of estrogen [44], but the sub- strate of CYP1A1 is not yet known. Cyp1a1 and Cyp1a2 are ... counterparts. We conducted a detailed analysis of Cyp1b1. Phylogenetic analysis of Cyp1b1 (Figure 5) suggests the exist- ence of two very close paralogs: Cyp1a1 and Cyp1a2. No equiv-...

Ngày tải lên: 14/08/2014, 08:20

19 340 0
Báo cáo y học: "Identification of novel Y chromosome encoded transcripts by testis transcriptome analysis of mice with deletions of the Y chromosome long arm" potx

Báo cáo y học: "Identification of novel Y chromosome encoded transcripts by testis transcriptome analysis of mice with deletions of the Y chromosome long arm" potx

... *********** ECTSFFPIVSHTYHYVIQLYNCNHFDQHSQEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFMCKLLPVLCYFPPDDSF1 ... Sry Sxr a 7 copies Rbmy Sry Zfy2 Uty Eif2s 3y Smcy Ube 1y Zfy1 Usp 9y Dby XSxr Y *xa XY Del 2/3 MSYq Del Sry Del 9/10 MSYq qdel XY RIII XY XY RIII Large X...

Ngày tải lên: 14/08/2014, 15:20

15 252 0
Báo cáo y học: " Identification of novel transcripts with differential dorso-ventral expression in Xenopus gastrula using serial analysis of gene expression" pptx

Báo cáo y học: " Identification of novel transcripts with differential dorso-ventral expression in Xenopus gastrula using serial analysis of gene expression" pptx

... stage. Importantly, 86 tags of those expressed differ- entially correspond to novel transcripts. Regulation of expression by -catenin of novel transcripts identified by SAGE Many of the genes involved ... carry out a SAGE experiment as a proof of Effect of Wnt signaling on expression of novel transcriptsFigure 5 Effect of Wnt signaling on expression of novel transc...

Ngày tải lên: 14/08/2014, 21:20

16 332 0
Báo cáo Y học: Toxicity of novel C-terminal prion protein fragments and peptides harbouring disease-related C-terminal mutations pdf

Báo cáo Y học: Toxicity of novel C-terminal prion protein fragments and peptides harbouring disease-related C-terminal mutations pdf

... true C-terminal fragment of PrP c may form a novel conformation as yet unknown. Support for this comes from the analysis by CD of two proteins PrP105–231 and PrP113–231 that have moderately different spectra ... 121–146(AVVGG LGYMLGSAMSRPIIHFGSDYED), PrP147– 171(RYYRE NMYRYPNQVYYRPVDQYSNQ), PrP163–184(RPVDQ YSNQNNFVHDCVNITIK), PrP180– 198(NITIKQHTVTT KGENFT) and PrP196–220(NFTETDVKM...

Ngày tải lên: 31/03/2014, 23:20

10 496 0
Báo cáo y học: "Analysis of HLA DR, HLA DQ, C4A, FcγRIIa, FcγRIIIa, MBL, and IL-1Ra allelic variants in Caucasian systemic lupus erythematosus patients suggests an effect of the combined FcγRIIa R/R and IL-1Ra 2/2 genotypes on disease susceptibility" pptx

Báo cáo y học: "Analysis of HLA DR, HLA DQ, C4A, FcγRIIa, FcγRIIIa, MBL, and IL-1Ra allelic variants in Caucasian systemic lupus erythematosus patients suggests an effect of the combined FcγRIIa R/R and IL-1Ra 2/2 genotypes on disease susceptibility" pptx

... previously described [20]. Analysis of Fc γ RIIIa gene polymorphism The analysis of the F/V polymorphism was performed essentially as previously described [21]. MBL gene polymorphism Variants of MBL ... minority of the patients had previously been typed with a lymphocytotoxicity test or by restriction fragment length polymorphism as described before [2]. C4A gene deletion was dete...

Ngày tải lên: 09/08/2014, 01:24

6 292 0
Báo cáo y học: "Analysis of immunoglobulin light chain rearrangements in the salivary gland and blood of a patient with Sjögren’s syndrome" pptx

Báo cáo y học: "Analysis of immunoglobulin light chain rearrangements in the salivary gland and blood of a patient with Sjögren’s syndrome" pptx

... 400 mg hydroxychloroquine and 2 mg prednisone daily at the time of analysis. After developing parotid gland enlargement, lymphoma of the parotid gland was excluded by partial parotidectomy and ... gland of a patient fulfilling the revised criteria for classification of SS [8] were analyzed. The patient was a 76-year-old female who manifested a typical histology of the minor saliv...

Ngày tải lên: 09/08/2014, 03:24

12 441 0
Báo cáo y học: "Analysis of Fcγ receptor haplotypes in rheumatoid arthritis: FCGR3A remains a major susceptibility gene at this locus, with an additional contribution from FCGR3B" ppsx

Báo cáo y học: "Analysis of Fcγ receptor haplotypes in rheumatoid arthritis: FCGR3A remains a major susceptibility gene at this locus, with an additional contribution from FCGR3B" ppsx

... significance. Several methods have been proposed for the analysis of such data in the absence of family data and the consequent pres- ence of phase uncertainty. The HTR method we have chosen to ... study, do not allow a calculation of the gene copy number. This may provide an explanation for a failure of our control populations to conform to Hardy–Weinberg equi- librium and...

Ngày tải lên: 09/08/2014, 07:20

9 450 0
Báo cáo y học: "Analysis of normal and osteoarthritic canine cartilage mRNA expression by quantitative polymerase chain reacti" potx

Báo cáo y học: "Analysis of normal and osteoarthritic canine cartilage mRNA expression by quantitative polymerase chain reacti" potx

... followed by 40 cycles of 95°C for 1 minute and 60°C for 15 seconds, as recommended by the manufacturer (Applied Biosystems). Real-time data were ana- lysed by using the Sequence Detection Systems software, version ... results of a preliminary canine- specific whole genome microarray study, using a small number of samples. Assays were designed for quantification of expres- sion...

Ngày tải lên: 09/08/2014, 08:22

9 386 0
Báo cáo y học: "Analysis of bronchoalveolar lavage fluid proteome from systemic sclerosis patients with or without functional, clinical and radiological signs of lung fibrosis" pot

Báo cáo y học: "Analysis of bronchoalveolar lavage fluid proteome from systemic sclerosis patients with or without functional, clinical and radiological signs of lung fibrosis" pot

... University of Pavia, Via Taramelli 5, 27100 Pavia, Italy 2 Department of Biochemistry, University of Pavia, Via Taramelli 5, 27100 Pavia, Italy 3 Department of Internal Medicine, University of Pavia, ... (performed on cyto-centrifuged preparations with the use of May–Grünwald–Giemsa and Papanicolaou stain- ings) and the percentages of CD4 + and CD8 + T cells (assessed by cytof...

Ngày tải lên: 09/08/2014, 08:22

11 478 0
Từ khóa:
w