Báo cáo y học: "CCR3, CCR5, CCR8 and CXCR3 expression in memory T helper cells from allergic rhinitis patients, asymptomatically sensitized and healthy individual" docx
Báo cáo y học: "CCR3, CCR5, CCR8 and CXCR3 expression in memory T helper cells from allergic rhinitis patients, asymptomatically sensitized and healthy individual" docx
... with respect to CCR3, CCR5, CCR8 and CXCR3 in memory Th cells from allergic, asymptomatically sensi- tized and healthy individuals to obtain knowledge about their migratory potential and any ... found in receptor expression patterns immediate ex vivo for CCR3, CCR5, CCR8 and CXCR3 in memory Th cells from allergic, asymptomatically sensitized...
Ngày tải lên: 13/08/2014, 13:22
Tài liệu Báo cáo Y học: Binding of gelsolin domain 2 to actin An actin interface distinct from that of gelsolin domain 1 and from ADF/cofilin pptx
... similar to the actin depolymerizing factor (ADF)/cofilin family of actin-binding proteins and it has been proposed that there is a similarity in the actin-binding interface. Gelsolin domains 1 and ... (S1) interacts both with monomeric actin, and with the barbed end of the actin filaments inhibiting polymerization. S2, in contrast, preferably binds to the side of the actin filament. Se...
Ngày tải lên: 22/02/2014, 07:20
Báo cáo y học: " Tumour necrosis factor-α stimulates dehydroepiandrosterone metabolism in human fibroblast-like synoviocytes: a role for nuclear factor-κB and activator protein-1 in the regulation of expression of cytochrome p450 enzyme 7b" doc
... inhibition did not affect the TNF-α-induced increase in Cyp7b activity We further investigated a putative role for MAPKs in the TNF- α-induced increase in Cyp7b activity by using the MEK1 inhib- itor ... signal transduction pathway is involved in the TNF-α-mediated induction of Cyp7b activity in FLS. We studied the effects of inhibitors of different signal transduction pathways on...
Ngày tải lên: 09/08/2014, 07:20
Báo cáo y học: "Early Characterization of Toll-like receptors in primary lung epithelial cells: strong impact of the TLR3 ligand poly(I:C) on the regulation of Toll-like receptors, adaptor proteins and inflammatory response" ppt
... (TP) 5'-TGAACTGGACTTCTCCCATTTCCGTCTTTT-3' TLR3 (FP) 5'-CCTGGTTTGTTAATTGGATTAACGA-3' TLR3 (RP) 5'-GAGGTGGAGTGTTGCAAAGGTAGT-3' TLR3 (TP) 5'-CCCATACCAACATCCCTGAGCTGTCAA-3' TLR4 ... demonstrate that the expression of TLRs and their signaling proteins in SAEC is strongly regulated by type-1 and type-2 cytokines. These findings are thought to have a m...
Ngày tải lên: 11/08/2014, 08:21
Báo cáo y học: "A dynamic model of gene expression in monocytes reveals differences in immediate/early response genes between adult and neonatal cells" potx
... advantages, at least in the initial phases of investigation, by allowing investigators to survey the pan- oply of biological processes that may be relevant to iden- tifying critical biological distinctions. Recently ... profil- ing will be demonstrated only if they provide insights into relevant physiologic or pathophysiologic function. For that reason, we elected to test the validity of th...
Ngày tải lên: 11/08/2014, 08:21
Báo cáo y học: " Persistent resistance to HIV-1 infection in CD4 T cells from exposed uninfected Vietnamese individuals is mediated by entry and post-entry blocks" potx
... suggesting that the mechanisms of resist- ance in these subjects do not depend on exposure to the virus but rather might be linked to constitutive factors. It is noteworthy in this respect that heterozygous ... and found that both entry and post-entry steps of HIV-1 replication could be affected. Interestingly, the restriction in one of these subjects also affected other lentiviruse...
Ngày tải lên: 13/08/2014, 09:20
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT 399 AKR6 YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT 400 1E YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT ... PCLSTTVLNLTTDYCVLVELWPKVTYHSPDYVYGQFEKKTKYKREPVSLTLALLLGGLTMGG 461 AKR6 PCLSTTVLNLTTDYCVLVELWPKVTYHSPDYVYGQFEKKTKYKREPVSLTLALLLGG...
Ngày tải lên: 13/08/2014, 09:21
Báo cáo y học: "Stimulation of Apolipoprotein A-IV expression in Caco-2/TC7 enterocytes and reduction of triglyceride formation in 3T3-L1 adipocytes by potential anti-obesity Chinese herbal medicines" ppsx
... herbs against obesity in terms of stimulating ApoA-IV promoter activity in gut cells and reducing TG content in adipocytes was tested in the present study. Rhizoma Alismatis (A), Fructus Crataegi ... atheroscle- rosis by modulating plasma lipoprotein metabolism [12] and inhibit gastric motility, acid secretion [13-15] and intestinal motility [16]. More importantly, ApoA-IV may...
Ngày tải lên: 13/08/2014, 15:21
Báo cáo y học: "A global view of gene expression in lithium and zinc treated sea urchin embryos: new components of gene regulatory network" pot
... 'a' in Tables 1, 2, and 3). To identify the biologic pathways affected by the treatments, we analyzed the expression data in terms of pathways. To sort sea urchin genes into pathways we mapped the ... (as verified by Q-PCR; Table 1). Because lithium treatment is thought to activate Wnt (wingless int) signaling by stabilizing β-catenin, we investigated the expression of Wnt...
Ngày tải lên: 14/08/2014, 07:21
Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx
... ACCTTCACACCAAACAT (Hnf4a); AATGCAGAGGAGGACTC (Neurod1); CAGGGTTTCTGAGCTTC (Neurog3); TCATTTGACTTTTTTTT (Isl1); GATTTAAGAGTTTTATC (Pax6); CAGCAGGACGGACTCAG (Pax4); CAGTCCATCAACGACGC (Ptf1a); ... AGAAACAGCAGGGCCTG (Bhlhb8); GACCACACTGTCAAACA (Cpa1); CCCTGGGTTCAGGAGAT (Ctrb1); TTGCGCTTCCTGGTGTT (Ela1); ACCACCTGGTAACCGTA (Gcg); GCCGGGCCCTGGGGAAG (Ghrl); CTAAGAATTGCTTTAAA (Iapp); GCCCTGTTG...
Ngày tải lên: 14/08/2014, 20:22