Báo cáo y học: "CCR3, CCR5, CCR8 and CXCR3 expression in memory T helper cells from allergic rhinitis patients, asymptomatically sensitized and healthy individual" docx

... with respect to CCR3, CCR5, CCR8 and CXCR3 in memory Th cells from allergic, asymptomatically sensi-tized and healthy individuals to obtain knowledge abouttheir migratory potential and any ... found in receptor expression patterns immediate ex vivo for CCR3, CCR5, CCR8 and CXCR3 in memory Th cells from allergic, asymptomatically sensitized and healthy individualsdespite the fact that the ... blood Th cells [21] in patients with atopic dermatitis and healthy controls,but in disagreement with other findings showingdecreased percentage of CCR5+ and CXCR3+ memory Th cells in the blood from...

Tài liệu Báo cáo Y học: Binding of gelsolin domain 2 to actin An actin interface distinct from that of gelsolin domain 1 and from ADF/coﬁlin pptx

... similar to the actindepolymerizing factor (ADF)/coﬁlin family of actin-bindingproteins and it has been proposed that there is a similarity in the actin-binding interface. Gelsolin domains 1 and ... (S1) interacts both with monomeric actin, and with the barbed end of the actin ﬁlaments inhibitingpolymerization.S2, in contrast, preferably binds to the side of the actinﬁlament. Severing activity ... located in the blood and acts with vitaminD-binding protein to accelerate clearing of actin from thecirculation [4], while the other form is intracellular. In vitro,gelsolin interacts with...

Báo cáo y học: " Tumour necrosis factor-α stimulates dehydroepiandrosterone metabolism in human fibroblast-like synoviocytes: a role for nuclear factor-κB and activator protein-1 in the regulation of expression of cytochrome p450 enzyme 7b" doc

... inhibition did not affect the TNF-α-induced increase in Cyp7b activityWe further investigated a putative role for MAPKs in the TNF-α-induced increase in Cyp7b activity by using the MEK1 inhib-itor ... signal transduction pathway is involved in theTNF-α-mediated induction of Cyp7b activity in FLS. We studiedthe effects of inhibitors of different signal transduction pathwayson Cyp7b activity in ... Cyp7b activity (Fig. 1a). Impor-tantly, the increase in Cyp7b activity following stimulation ofthe cells with TNF-α was dose-dependently inhibited by SN50(Fig. 1a).To further substantiate...

Báo cáo y học: "Early Characterization of Toll-like receptors in primary lung epithelial cells: strong impact of the TLR3 ligand poly(I:C) on the regulation of Toll-like receptors, adaptor proteins and inflammatory response" ppt

... (TP) 5'-TGAACTGGACTTCTCCCATTTCCGTCTTTT-3'TLR3 (FP) 5'-CCTGGTTTGTTAATTGGATTAACGA-3'TLR3 (RP) 5'-GAGGTGGAGTGTTGCAAAGGTAGT-3'TLR3 (TP) 5'-CCCATACCAACATCCCTGAGCTGTCAA-3'TLR4 ... demonstrate that the expression of TLRs and theirsignaling proteins in SAEC is strongly regulated by type-1 and type-2 cytokines. These findings are thought to have amajor effect on the impact ... 5'-TTTCCTTGGGCCATTCCA-3'TLR1 (TP) 5'-CAGTTATCACAAGCTCAAAAGTCTCATGGCCA-3'TLR2 (FP) 5'-TGTGAAGAGTGAGTGGTGCAAGT-3'TLR2 (RP) 5'-ATGGCAGCATCATTGTTCTCAT-3'TLR2...

Báo cáo y học: "A dynamic model of gene expression in monocytes reveals differences in immediate/early response genes between adult and neonatal cells" potx

... advantages, at least in the initial phases ofinvestigation, by allowing investigators to survey the pan-oply of biological processes that may be relevant to iden-tifying critical biological distinctions.Recently ... profil-ing will be demonstrated only if they provide insights intorelevant physiologic or pathophysiologic function. Forthat reason, we elected to test the validity of the array databy examining ... interestingto speculate that the related blunted neonatal response toinflammatory stimuli (including infection) may result, atleast in part, from the excessive production of apoptotic cells during...

Báo cáo y học: " Persistent resistance to HIV-1 infection in CD4 T cells from exposed uninfected Vietnamese individuals is mediated by entry and post-entry blocks" potx

... suggesting that the mechanisms of resist-ance in these subjects do not depend on exposure to thevirus but rather might be linked to constitutive factors. Itis noteworthy in this respect that heterozygous ... and found that both entry and post-entry steps of HIV-1 replication could be affected.Interestingly, the restriction in one of these subjects alsoaffected other lentiviruses. In addition, the ... activity in cell lysates three days after infection. Luciferase activity in cell lysates from a representative control was attributed a value of 100%. Error bars represent-ing standard deviation...

Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT 399 AKR6 YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT 400 1E YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT ... PCLSTTVLNLTTDYCVLVELWPKVTYHSPDYVYGQFEKKTKYKREPVSLTLALLLGGLTMGG 461 AKR6 PCLSTTVLNLTTDYCVLVELWPKVTYHSPDYVYGQFEKKTKYKREPVSLTLALLLGGLTMGG 462 1E PCLSATVLNRTTDYCVLVELWPRVTYHPPSYVYSQFEKSYRHKREPVSLTLALLLGGLTMGG ... determinedby comparing the vector titer on mock infected cells tothat obtained on cells infected with AKR6 or 1E viruses.Competing interestsThe author(s) declare that they have no competing...

Báo cáo y học: "Stimulation of Apolipoprotein A-IV expression in Caco-2/TC7 enterocytes and reduction of triglyceride formation in 3T3-L1 adipocytes by potential anti-obesity Chinese herbal medicines" ppsx

... herbs againstobesity in terms of stimulating ApoA-IV promoter activity in gut cells and reducing TG content in adipocytes wastested in the present study. Rhizoma Alismatis (A), FructusCrataegi ... atheroscle-rosis by modulating plasma lipoprotein metabolism [12] and inhibit gastric motility, acid secretion [13-15] and intestinal motility [16]. More importantly, ApoA-IV maybe involved in the control ... reduce food intakeby potentiating the anorectic effect of central melanocor-tin agonists [19]. Hypothalamic melanocortin system iscritical in the regulation of food intake and body weight[22]....

Báo cáo y học: "A global view of gene expression in lithium and zinc treated sea urchin embryos: new components of gene regulatory network" pot

... 'a' in Tables 1, 2, and 3).To identify the biologic pathways affected by the treatments,we analyzed the expression data in terms of pathways. To sortsea urchin genes into pathways we mapped the ... (asverified by Q-PCR; Table 1). Because lithium treatment isthought to activate Wnt (wingless int) signaling by stabilizingβ-catenin, we investigated the expression of Wnt genes in treated embryos. ... treatment, as well as from untreated embryos atcorresponding time points by extraction with Trizol (GibcoBRL), following the manufacturer's instructions. The integ-rity of the resulting...

Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx

... ACCTTCACACCAAACAT (Hnf4a); AATGCAGAGGAGGACTC (Neurod1); CAGGGTTTCTGAGCTTC (Neurog3); TCATTTGACTTTTTTTT (Isl1); GATTTAAGAGTTTTATC (Pax6); CAGCAGGACGGACTCAG (Pax4); CAGTCCATCAACGACGC (Ptf1a); ... AGAAACAGCAGGGCCTG (Bhlhb8); GACCACACTGTCAAACA (Cpa1); CCCTGGGTTCAGGAGAT (Ctrb1); TTGCGCTTCCTGGTGTT (Ela1); ACCACCTGGTAACCGTA (Gcg); GCCGGGCCCTGGGGAAG (Ghrl); CTAAGAATTGCTTTAAA (Iapp); GCCCTGTTGGTGCACTT ... development that predicts many novelinteractions that are of great interest for future analysis. In sum, these data provide insight into the regulatory networksdriving pancreas development and function...

Xem thêm

Từ khóa: Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018 Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thống Báo cáo quy trình mua hàng CT CP Công Nghệ NPV Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP Nghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THz Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM