Báo cáo y học: "The human allergens of mesquite (Prosopis juliflora)" pptx
... then interpreted by Gel-Pro software. Results: Thirteen human allergens of mesquite pollen were detected in this study. Conclusion: The number of allergens in this study of mesquite exceeded ... allergy needed to be established. The aim of the current study was to amplify the present knowledge of mesquite allergens which affect humans preliminary to investigating the i...
Ngày tải lên: 13/08/2014, 13:22
... indef- initely. Alternatively, the arrested tumor cells might pro- duce – directly, by releasing inhibitory factors, or indirectly, by attracting inflammatory cells that in turn release inhibitory factors ... lowering of the regenerative capacity of the second tissue. If an injury were incurred in the second tissue, simultaneously or subsequently – most probably associated with the pre-ac...
Ngày tải lên: 13/08/2014, 16:21
... Nucleosome fractionation by mercury affinity chromatography: contrasting distribution of transcrip- tionally active and acetylated histones in nucleosome fractions of wild-type yeast cells and cells ... ubiquitously expressed member o f the HLH family of proteins and binds to DNA as a heterodimer usually composed of USF1 and USF2. USF has been implicated in the r egulation of m any ge...
Ngày tải lên: 18/03/2014, 01:20
Báo cáo Y học: The a1b1 contact of human hemoglobin plays a key role in stabilizing the bound dioxygen Further evidence from the iron valency hybrids potx
... proton catalysis performed by the distal histidine residue (Eqn 4). Similarly, Shaanan [31] reported the stereochemistry of the iron-dioxygen bond in human HbO 2 by single-crystal X-ray analysis. In ... access of a proton to the bound dioxygen cannot yield such an enzyme-like, catalytic e ffect on the autoxidation rate of MbO 2 or HbO 2 . Insofar as we have examined for more than a do...
Ngày tải lên: 31/03/2014, 15:20
Báo cáo y học: "The active metabolite of leflunomide, A77 1726, increases the production of IL-1 receptor antagonist in human synovial fibroblasts and articular chondrocytes" ppsx
... production by synovial fibroblasts and chondrocytes in the presence of proinflammatory cytokines, and thus it may possess chondroprotective effects. The effect of A77 1726 may be partially mediated by ... Magne 1 , Cem Gabay 1 , Jean-Michel Dayer 2 and Pierre-André Guerne 1 1 Division of Rheumatology, University Hospital, and Department of Pathology, University of Geneva School of...
Ngày tải lên: 09/08/2014, 01:23
Báo cáo y học: "The critical role of arginine residues in the binding of human monoclonal antibodies to cardiolipin" ppsx
... presence of bovine and human β 2 GPI, and to human β 2 GPI alone [31]. B3 [32] and UK4 [33] were isolated by fusion of peripheral B lymphocytes from systemic lupus erythematosus patients with cells of ... Heavy chains FR1 CDR1 FR2 CDR2 FR3 CDR3 J H 30 31 36 40 50 60 70 82 90 100 101 abc 1-03 QVQLVQSGAEVKKPGASVKVSCKASGYTFT SYAMH WVRQAPGQRLEWMG WINSGNGNTKYSQKFQG RVTITRDTSASTAYMELSSLRS...
Ngày tải lên: 09/08/2014, 06:22
Báo cáo y học: "The human anti-IL-1β monoclonal antibody ACZ885 is effective in joint inflammation models in mice and in a proof-of-concept study in patients with rheumatoid arthritis" doc
... study ACZ885 in a dose-escalating, proof -of- concept study in patients with RA – the first of its kind in humans. The study's primary objective was to investigate safety and tolerability; ... observation prompted us to study the safety, tolerability and pharmacodynamic activity of ACZ885 in RA patients in a small proof -of- concept study – the first to be conducted in humans. Patien...
Ngày tải lên: 09/08/2014, 10:23
Báo cáo y học: "The draft genome of the carcinogenic human liver fluke Clonorchis sinensis" pptx
... for the fatty acid biosynthesis pathway only three enzymes were detected: 3-oxoacyl-[acyl-carrier-protein] synthase II (FabF), acetyl-CoA carboxylase (EC 6.4.1.2, 6.3.4.14) and [acyl-carrier-protein] ... pathways for glycolysis, the Krebs cycle and fatty acid metabolism were found, but key genes involved in fatty acid biosynthesis are missing from the genome, reflecting the parasitic life...
Ngày tải lên: 09/08/2014, 23:20
Báo cáo y học: "The first report of human illness associated with the Panola Mountain Ehrlichia species: a case report" doc
... publication of this case report. A copy of the written consent is available for review by the Editor-in-Chief of this journal. Acknowledgements Diagnostic laboratory work was supported by the CDC ... antibodies against ehrlichial agents are often, but not always, cross- reactive with other species of Ehrlichia [3]. In this case, PCR testing of whole blood was of significantly grea...
Ngày tải lên: 11/08/2014, 23:21
Báo cáo y học: "The immediate effects of local and adjacent acupuncture on the tibialis anterior muscle: a human study'''' pdf
... 2 Laboratory of Bioengineering, Neuropsychobiology and Motor Behavior, Department of Biomechanics, Medicine and Rehabilitation of the Locomotor System, School of Medicine – University of São Paulo, ... registration of rest position, (2) electromyography registration of the isomet- ric dorsiflexion, (3) acupuncture at either ST36 or SP9 acupoints for 20 minutes, (4) electromyog...
Ngày tải lên: 13/08/2014, 15:21