Báo cáo y học: "High-molecular-weight hyaluronan – a possible new treatment for sepsis-induced lung injury: a preclinical study in mechanically ventilated rats" ppsx
Báo cáo y học: "Adalimumab - an effective and promising treatment for patients with fistulizing Crohn’s disease: a case series" pdf
... induction therapy [7,8]. The ACCENT II trial assessed the efficacy of inflixi- mab maintenance therapy in adult patients with CD who had at least one draining abdominal or peri-anal fistula over a period ... placebo for fistula healing in FCD. The above, more detailed, analysi s elevated the results from the ACCENT II study on the safety and efficacy of infliximab in inducing and...
Ngày tải lên: 11/08/2014, 00:23
Báo cáo y học: " Multifamily Group Psychoeducation and Cognitive Remediation for First-Episode Psychosis: A Randomized Controlled Trial" pdf
... remediation program provides participants with training in 4 areas of cognitive f unc- tioning: attention, visual-spatial abilities, memory, and problem-solving abilities. Participants initially ... may experience a symptomatic relapse and 50% may be hos- pitalized over a two-year period despite participating in family psychoeducation [11,13]. Thus, despite the clear clinical benefits...
Ngày tải lên: 11/08/2014, 16:22
Báo cáo y học: "The development of the Quality Indicator for Rehabilitative Care (QuIRC): a measure of best practice for facilities for people with longer term mental health problems" potx
... unannounced Figure 2 Items dropped after Exploratory Factor Analysis. Table 2 Sampling adequacy and internal consistency of domains after 3 rd iteration of exploratory factor analysis Domain ... Double data entry was completed f or 10% of the toolkit data using a separate da tabase and the study statistician car- ried out data validation on the two databases for each centre. The maxi...
Ngày tải lên: 11/08/2014, 16:23
Báo cáo y học: " Factors associated with dropout from treatment for eating disorders: a comprehensive literature review" pdf
... conceivable that administration of treatments in sequential order [56] may allow clinicians to address issues that may hinder adequate collaboration with treatment. This as yet untested approach may ... termination) that may find applicability in EDs [61]. The sequential model may again be appropriate for improving readiness to change before treatment of EDs, thus potentially yieldin...
Ngày tải lên: 11/08/2014, 17:20
Báo cáo y học: " Traumatic posterior urethral fistula to hip joint following gunshot injury: a case report" docx
... [9]. Voiding cystourethrography (VCUG) and urethrography are the mainstays to study lower urinary tract symptoms [9]. They show an irregular tract ending in a cavity. Magnetic resonance imaging (MRI) ... surgery for the urethral stricture using a bladder epithelial graft and urethral fis- tula via a transperineal approach. The patient was placed in an exaggerated lithotomy posit...
Ngày tải lên: 11/08/2014, 17:21
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx
... Â 189 Human EFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQ 237 Mouse EFEFAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQ 237 Bee RFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQ PSAQCEATTMQENDK ... non-synonymous (Ka) Amino acid alignment of human Hyal2, C3H mouse Hyal2, and bee venom HyaFigure 5 Amino acid alignment of human Hyal2, C3H mouse Hyal2, and bee venom Hya. Protei...
Ngày tải lên: 13/08/2014, 09:21
Báo cáo y học: "The EVIDEM framework and its usefulness for priority setting across a broad range of health interventions" docx
... questionnaire, an approach that facilitates MDCA, and distributed this among 24 national health policymakers, 55 health pro- fessionals, and 163 general populations. Third, our DCE analyses resulted in ... Koolman X, Lauer J, Osei D, Adjei S: Balancing equity and efficiency in health priorities in Ghana: The use of multicriteria decision analysis. Value in Health 2008, 11:1081-1087. 6...
Ngày tải lên: 13/08/2014, 11:22
Báo cáo y học: "Computed tomography to estimate cardiac preload and extravascular lung water. A retrospective analysis in critically ill patients" ppt
... 34(6):1647-1653. 14. Tagami T, Kushimoto S, Yamamoto Y, Atsumi T, Tosa R, Matsuda K, Oyama R, Kawaguchi T, Masuno T, Hirama H, et al: Validation of extravascular lung water measurement by single transpulmonary thermodilution: ... are hardly transferable to critically ill patients, because the study was conducted using special analyzing software and a lung model (air-dried, ex-sanguin...
Ngày tải lên: 13/08/2014, 23:20
Báo cáo y học: " Reduced peak oxygen uptake and implications for cardiovascular health and quality of life in patients with schizophrenia" ppsx
... Kodama S, Saito K, Tanaka S, Maki M, Yachi Y, Asumi M, Sugawara A, Totsuka K, Shimano H, Ohashi Y, Yamada N, Sone H: Cardiorespiratory fitness as a quantitative predictor of all-cause mortality ... Nord-Trøndelag Health Study (the HUNT Study) demonstrate that physical active people with a clustering of cardiovascular risk factors appears to have comparable risk of premature dea...
Ngày tải lên: 11/08/2014, 16:21
Báo cáo y học: "Histone deacetylase inhibitor, butyrate, attenuates lipopolysaccharide-induced acute lung injury in mice" pptx
... administration of butyrate was applied orally not intranasally. Butyrate is an anti- tumor agent, so it is cytotoxi c. Therefore, the intranasal delivery of butyrate may be harmful to the nasal mucosa. ... present study, interestingly, our results indi- cated that administration of butyrate in vivo attenuated pulmonary inflammation in LPS-induced ALI. The r ea- son for the discrepancy...
Ngày tải lên: 12/08/2014, 11:21