Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
... +secondaryantibody8 3A2 5 +secondaryantibodyAKR6 +8 3A2 5 +secondaryantibody8 3A2 5 +secondaryantibodyAKR6 +8 3A2 5 +secondaryantibody8 3A2 5 +secondaryantibodyAKR6 +8 3A2 5 +secondaryantibody150120906030015012090603001501209060300Retrovirology ... but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia virusesNeal S Van Hoeven1,2,3 and A Dusty Miller*1Address: ... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT 399 AKR6 YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT 400 1E YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT...
- 12
- 227
- 0
Tài liệu Báo cáo Y học: Use of site-specific recombination as a probe of nucleoprotein complex formation in chromatin Micha Schwikardi and Peter Droge ¨ potx
... [14]. Strand exchange is catalyzed by dimersbound at paired sites I, while those bound at sites II and IIIserve accessory roles in synaptosome formation and in theactivation of strand cleavage ... nucleosomal organization.Our analysis employing inhibitors of histone deacetylase and topoisomerases revealed that the reactivity of resremained unaffected, even though the transcriptional activity of ... was necessary to analyzerecombination on linearized episomal substrates as theybetter resemble the topology of targets placed in chromatinthan circular substrates used before.The recombination...
- 7
- 472
- 0
Báo cáo y học: " Use of intra-medullary stacked nailing in the reduction of proximal plastic deformity in a pediatric Monteggia fracture: a case report" pptx
... Open Access Use of intra-medullary stacked nailing in thereduction of proximal plastic deformity in a pediatric Monteggia fracture: a case reportJason Lim1 and James S Huntley2*AbstractIntroduction: ... this article as: Lim and Huntley: Use of intra-medullary stackednailing in the reduction of proximal plastic deformity in a pediatricMonteggia fracture: a case report. Journal of Medical Case ... impossible.Case presentation: We report the case of a four-year-old Caucasian boy in whom the plastic deformation of theproximal ulna was reduced, and this reduction was maintained, using intra-medullary...
- 5
- 372
- 0
Báo cáo y học: " Use of Chinese medicine by cancer patients: a review of surveys" pps
... Complementary and alternativemedicine use, spending, and quality of life in early stage breast cancer.Nurs Res 2010, 59:58-66.92. Adams J: Researching Complementary and Alternative Medicine Abingdon:Routledge; ... participant population and the generalisability of thefindings was not justified. Fourthly, qualitative researchaccompanied by cross sectional and longitudinal surveys and additional information about ... vomiting,changes in bowel habits, fatigue and hair loss. Chinesemedicin e is increasing ly used as an adjunctive treatmentoption for cancer patients and a way of re ducing ormanaging side effects of...
- 8
- 321
- 0
Báo cáo y học: "Enrichment of intersubtype HIV-1 recombinants in a dual infection system using HIV-1 strain-specific siRNAs" pps
... virusproduction, but eventually all susceptible cells areexhausted for infection in the culture. Thus, parentalviruses (e.g. A and B) always dominate a dual infection and b asically obscuring the characterization ... recombinants by blocking each of twoparental HIV-1 isolates in a dual infection with strain-specific siRNAs. Using this approach, we could easilydetect, map, and characterize intersubtype breakpoints in ... recombinants between the subtype A v120 -A and subtype D v126-D. Alternatively, siRNAmay have selected for v120 -A and/ or v126-D withnucleotide substitutions in the siRNA12 0a and siR-NA12 6a target...
- 12
- 250
- 0
Báo cáo y học: "dentification of the protease cleavage sites in a reconstituted Gag polyprotein of an HERV-K(HML-2) element" doc
... Germany) and mixed with 1 μl alpha-Cyano-4-hydroxy-cinnamic acid(HCCA) solution (6 mg/ml in TA2) and air dried.Parameters of MALDI-TOF mass spectrometryMass spectra were collected by an Autoflex ... and separated by reversephase HPLC and, with the help of the specific sera and antibodies, the fractions containing MA, CA and variantforms of a p15 protein, presumed to reside between MA and ... silver nitrate staining. (D) MALDI-TOF analysis of wt NC and the F624D mutant. The NC subdomains were purified byRP-HPLC and trypsin digested before MALDI-TOF analysis. Peaks of the wt and of the...
- 15
- 374
- 0
Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx
... pair:5'-CCAGCTTTGGGCTGAATGGAACAAAAACTTATTTCT-GAAGAA GATCTGATGGCAGCACCCACG 3' and 5'-CGT-GGGTGCTGCCATCAGATCTTCT TCAGAAATAAGTTTTTGTTCCATTCAGCCCAAAGCTGG-3'. MuPAR regionswere introduced ... HuPAR2 primers and probe used were 5'-GCCT-GTTGTACCTCTAATGTCACT-3' (forward) and 5'-GAC-CCAGGAAGAAAGACCGTAAG-3' (reverse); HuPAR2probe, 5'-FAM TTCCTGAGCCACCTGCCACCTCCT ... 65:371-389.50. Andriamampandry C, Taleb O, Kemmel V, Humbert JP, Aunis D, Mai-tre M: Cloning and functional characterization of a gamma-hydroxybutyrate receptor identified in the human brain.Faseb J...
- 15
- 330
- 0
Báo cáo y học: " Sinusoidal obstruction syndrome (veno-occlusive disease) in a patient receiving bevacizumab for metastatic colorectal cancer: a case report" pptx
... by Bilchik etPAS diastase and Van Gieson stainsFigure 2PAS diastase and Van Gieson stains. (a) PAS diastase stain showing Kupffer cell hyperplasia. (b) Van Gieson stain showing pericellular ... chemotherapy and radiotherapy. In normal tissues its action is stabilisation of mature cells. Ithas a beneficial effect in angiogenesis during wound heal-ing [2].Our patient had had a partial hepatectomy ... hepatectomy (trisectionec-tomy) in the past and had also received oxaliplatin-basedchemotherapy, a drug recently found to cause hepaticsinusoidal dilatation in hepatectomy specimens. To datewe have...
- 4
- 479
- 0
Báo cáo y học: "Use of chinese and western over-the-counter medications in Hong Kong"
... role of medical professionals is a dominant factor in defining, controlling and scoping the work of theallied health professionals [21,22] as extending pharma-cists’ roleinprimarycaremayaffecttheautonomyandcontrol ... pharmacistconsultations in primary care. Fam Pract 2000, 17(6):480-3.4. Hassell K, Rogers A, Noyce P: Community pharmacy as a primary health and self-care resource: a framework for understanding pharmacyutilization. ... disease status as informed by a western medi-cine practitioner and self perceived level of health and possession of western or Chinese medicine insurancecoverage.Our data analysisAnalysis of...
- 9
- 516
- 0
Báo cáo y học: "Use of the measure your medical outcome profile (MYMOP2) and W-BQ12 (Well-Being) outcomes measures to evaluate chiropractic treatment: an observational study"
... change and may be a useful instrument for assessing clinical changes among chiropractic patients who present with a variety of symptoms and clinicalconditions.Background In an era of accountability, ... accountability, health care providers areincreasingly required to use reliable and valid outcomemeasures to assess changes in patient characteristics,including function and activities of daily living, ... during a consultation [1].It has been used successfully to evaluate patient out-comes in a number of clinical settings including acu-puncture [2,5], massage therapy in an Aboriginalcommunity...
- 8
- 538
- 0
Từ khóa: báo cáo y họcbáo cáo y học cổ truyềnmẫu báo cáo y học cổ truyềnbao cao y hoc colchicinphan ban luan trong bao cao y hoc co truyenbáo cáo khoa học y họcbáo cáo y tế học đườngmẫu báo cáo y tế học đườngbáo cáo y tế học đường cuối nămbáo cáo y tế học đường năm 2012báo cáo y tế học đường trường mầm nonbiểu mẫu báo cáo y tế trường họcbáo cáo y tế học đường trường tiểu họcbáo cáo y tế trường tiểu họcbáo cáo y tế trường học năm 2012Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015