Báo cáo y học: " Evolution of subtype C HIV-1 Env in a slowly progressing Zambian infant" potx

Báo cáo y học: " Evolution of subtype C HIV-1 Env in a slowly progressing Zambian infant" potx

Báo cáo y học: " Evolution of subtype C HIV-1 Env in a slowly progressing Zambian infant" potx

... clinically asymptomatic. Infant 1157 was infected in utero since HIV-1 sequences were detected by DNA PCR of infant blood samples collected at birth. The baby was delivered naturally, healthy ... of new HIV-1 infec- tions annually [4]. In sub-Saharan Africa, HIV-1 subtype C is responsible for approximately 50% of infections and a significant number of infections are i...
Ngày tải lên : 13/08/2014, 09:21
  • 15
  • 338
  • 0
Báo cáo y học: "Evolution of SIV toward RANTES resistance in macaques rapidly progressing to AIDS upon coinfection with HHV-6A" pptx

Báo cáo y học: "Evolution of SIV toward RANTES resistance in macaques rapidly progressing to AIDS upon coinfection with HHV-6A" pptx

... play a critical role in the early containment of HIV-1 replication [26]. This phenotypic switch is typically accompanied by an accelerated loss of CD4 + T cells. Strikingly, the emer- gence of ... progressor among singly-infected macaques developed an SIV variant with partial HHV- 6A/ RANTES resistance and increased replication capacity, associated with expanded coreceptor usage....
Ngày tải lên : 12/08/2014, 23:21
  • 11
  • 235
  • 0
Báo cáo Y học: Suppression of apolipoprotein C-II amyloid formation by the extracellular chaperone, clusterin potx

Báo cáo Y học: Suppression of apolipoprotein C-II amyloid formation by the extracellular chaperone, clusterin potx

... 300–400 lL were analyzed using the XL -A analytical ultracentrifuge. Radial scans were taken in continuous scanning mode and 0.002 cm radial increments. For samples containing apoC-II aggregates, the ... temperature. The presence of increasing concentrations of serum clusterin systematically reduces the accumulation of thioflavin T reactive material, with near complete suppression of...
Ngày tải lên : 24/03/2014, 04:21
  • 6
  • 300
  • 0
Báo cáo y học: " Distribution of hepatitis C virus genotypes in patients infected by different sources and its correlation with clinical and virological parameters: a preliminary study" pptx

Báo cáo y học: " Distribution of hepatitis C virus genotypes in patients infected by different sources and its correlation with clinical and virological parameters: a preliminary study" pptx

... third-gen- eration commercially available enzyme-linked immuno- surbent assay (ELISA) kits (ETI HCV K-3, DiaSorin, Spain) and HCV RNA detected qualitatively by reverse tran- scriptase polymerase chain reaction ... surface antibody), anti-HBcAb (hepatitis B core anti- body), splenomegaly, ascitis, edema, cirrhosis, grade and stage of liver biopsy, and child score and status (inactive, chroni...
Ngày tải lên : 13/08/2014, 13:20
  • 6
  • 337
  • 0
Báo cáo khoa học: Role of the C-terminal extension in a bacterial tyrosinase Michael Fairhead and Linda Thony-Meyer doc

Báo cáo khoa học: Role of the C-terminal extension in a bacterial tyrosinase Michael Fairhead and Linda Thony-Meyer doc

... Escherichia coli and characterization of the encoded tyrosinase. Enzyme Microb Technol 38, 772–779. 13 Kohashi PY, Kumagai T, Matoba Y, Yamamoto A, Maruyama M & Sugiyama M (2004) An efficient method ... 537–545. 47 Tatara Y, Namba T, Yamagata Y, Yoshida T, Uchida T & Ichishima E (2008) Acid activation of protyrosin- ase from Aspergillus oryzae: homo-tetrameric protyro- sinase...
Ngày tải lên : 06/03/2014, 11:20
  • 13
  • 778
  • 0
Báo cáo y học: " Role of the tachykinin NK1 receptor in a murine model of cigarette smoke-induced pulmonary inflammation" docx

Báo cáo y học: " Role of the tachykinin NK1 receptor in a murine model of cigarette smoke-induced pulmonary inflammation" docx

... involved in the accumulation of inflammatory cells in the airways during the inflammatory response to CS in a mouse model of COPD. As inflammation of the airways is an important characteristic of COPD, ... bred locally and maintained in a conventional animal house in the animal research facilities of the Faculty of Medicine and Health Sciences, Ghent University Hospi...
Ngày tải lên : 12/08/2014, 14:20
  • 12
  • 344
  • 0
Báo cáo y học: "Enrichment of intersubtype HIV-1 recombinants in a dual infection system using HIV-1 strain-specific siRNAs" pps

Báo cáo y học: "Enrichment of intersubtype HIV-1 recombinants in a dual infection system using HIV-1 strain-specific siRNAs" pps

... rapidly enrich for HIV-1 recombinants by blocking each of two parental HIV-1 isolates in a dual infection with strain- specific siRNAs. Using this approach, we could easily detect, map, and characterize ... Quinones-Mateu ME, Gao Y, Ball SC, Marozsan AJ, Abraha A, Arts EJ: In vitro intersubtype recombinants of human immunodeficiency virus type 1: comparison to recent and circu...
Ngày tải lên : 13/08/2014, 01:20
  • 12
  • 250
  • 0
Báo cáo y học: "dentification of the protease cleavage sites in a reconstituted Gag polyprotein of an HERV-K(HML-2) element" doc

Báo cáo y học: "dentification of the protease cleavage sites in a reconstituted Gag polyprotein of an HERV-K(HML-2) element" doc

... CA-NC scissil e bond, a canonical type II cleavage site [34], only partially inhibited processing, with a significant release ofthemature27kDaCAprotein still occurring. This indicat es that an ... (Bruker Daltonics, Bremen, Germany) and mixed with 1 μl alpha-Cyano-4-hydroxy-cinnamic acid (HCCA) solution (6 mg/ml in TA2) and air dried. Parameters of MALDI-TOF mass spectrometry Mass spe...
Ngày tải lên : 13/08/2014, 01:20
  • 15
  • 374
  • 0
Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx

Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx

... pair: 5'-CCAGCTTTGGGCTGAATGGAACAAAAACTTATTTCT- GAAGAA GATCTGATGGCAGCACCCACG 3' and 5'-CGT- GGGTGCTGCCATCAGATCTTCT TCAGAAATAAGTTT TTGTTCCATTCAGCCCAAAGCTGG-3'. MuPAR regions were introduced into ... 5'-GCCT- GTTGTACCTCTAATGTCACT-3' (forward) and 5'-GAC- CCAGGAAGAAAGACCGTAAG-3' (reverse); HuPAR2 probe, 5'-FAM TTCCTGAGCCACCTGCCACCTCCT BHQ- 3'. Fin...
Ngày tải lên : 13/08/2014, 05:21
  • 15
  • 330
  • 0
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

... + secondary antibody 8 3A2 5 + secondary antibody AKR6 + 8 3A2 5 + secondary antibody 8 3A2 5 + secondary antibody AKR6 + 8 3A2 5 + secondary antibody 8 3A2 5 + secondary antibody AKR6 + 8 3A2 5 + secondary antibody 150 120 90 60 30 0 150 120 90 60 30 0 150 120 90 60 30 0 Retrovirology ... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT 399 AKR6 YYEGVAVLGTYSN...
Ngày tải lên : 13/08/2014, 09:21
  • 12
  • 227
  • 0

Xem thêm

Từ khóa: