Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx

Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx

Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx

... c-myc tag was inserted into the pcDNA3.1(+)/Zeo HuPAR2 backbone by site-directed mutagenesis with the following primer pair: 5'-CCAGCTTTGGGCTGAATGGAACAAAAACTTATTTCT- GAAGAA GATCTGATGGCAGCACCCACG ... populations were assayed for PERV -A binding and infection by a FACS-based PERV -A SU IgG binding assay and a PERV pol qPCR-based infection assay. PERV pol copy numbers were normal- i...

Ngày tải lên: 13/08/2014, 05:21

15 330 0
Báo cáo y học: "Identification of novel DNA methylation inhibitors via a two-component reporter gene system" pptx

Báo cáo y học: "Identification of novel DNA methylation inhibitors via a two-component reporter gene system" pptx

... strategy for cancer treatment as demonstrated by the US Food and Drug Administration approval of the DNA methyltransferase inhibitors azacytidine and 5-aza-2’-deoxycytidine for the treatment of myelodysplastic ... f many diseases including cancer [1-7], targeting aberrant DNA methyla- tion is considered as a therapeutically relevant strategy for cancer treatment. Among many agents...

Ngày tải lên: 10/08/2014, 05:21

8 426 0
Báo cáo y học: "Identification of ciliary and ciliopathy genes in Caenorhabditis elegans through comparative genomics" pptx

Báo cáo y học: "Identification of ciliary and ciliopathy genes in Caenorhabditis elegans through comparative genomics" pptx

... patterns of all remaining candidate X-box containing genes from Additional data file 2 will be ascertained in a separate study. SAGE data analysis It is anticipated that the transcriptional expression ... protocol as detailed in the GeneChip Expression Analysis Technical Manual (provided by Affymetrix, Santa Clara, California, USA) [60]. GeneChip hybridization, washing, staining, and...

Ngày tải lên: 14/08/2014, 17:22

12 326 0
Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx

Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx

... (Pdx1); TAGTTTTAACAGAAAAC (Foxa2); ACCTTCACACCAAACAT (Hnf 4a) ; AATGCAGAGGAGGACTC (Neurod1); CAGGGTTTCTGAGCTTC (Neurog3); TCATTTGACTTTTTTTT (Isl1); GATTTAAGAGTTTTATC (Pax6); CAGCAGGACGGACTCAG (Pax4); ... CAGTCCATCAACGACGC (Ptf 1a) ; AGAAACAGCAGGGCCTG (Bhlhb8); GACCACACTGTCAAACA (Cpa1); CCCTGGGTTCAGGAGAT (Ctrb1); TTGCGCTTCCTGGTGTT (Ela1); ACCACCTGGTAACCGTA (Gcg); GCCGGGCCCTGGGGAAG (Ghr...

Ngày tải lên: 14/08/2014, 20:22

19 441 0
Báo cáo y học: "Activation of WNT and BMP signaling in adult human articular cartilage following mechanical injury" potx

Báo cáo y học: "Activation of WNT and BMP signaling in adult human articular cartilage following mechanical injury" potx

... (GeneBank:NM_002422 ), for- ward 5'-CAACCGTGAGGAAAATCGATGCAG-3', reverse 5'-CGGCAAGATACAGATTCACGCTCAA-3', 440 bp; MMP13 (GeneBank:NM_002427 ), forward 5'-ACGGAC- CCATACAGTTTGAATACAGC-3', ... catenin canonical pathway following mechani-cal injuryActivation of the WNT/β catenin canonical pathway following mechani- cal injury. (a) Axin-2 and (b) c-JUN mRNAs, tw...

Ngày tải lên: 09/08/2014, 08:22

13 418 0
Báo cáo y học: "Enrichment of intersubtype HIV-1 recombinants in a dual infection system using HIV-1 strain-specific siRNAs" pps

Báo cáo y học: "Enrichment of intersubtype HIV-1 recombinants in a dual infection system using HIV-1 strain-specific siRNAs" pps

... recombinants by blocking each of two parental HIV-1 isolates in a dual infection with strain- specific siRNAs. Using this approach, we could easily detect, map, and characterize intersubtype breakpoints in ... eventually all susceptible cells are exhausted for infection in the culture. Thus, parental viruses (e.g. A and B) always dominate a dual infection and b asically obsc...

Ngày tải lên: 13/08/2014, 01:20

12 250 0
Báo cáo y học: "dentification of the protease cleavage sites in a reconstituted Gag polyprotein of an HERV-K(HML-2) element" doc

Báo cáo y học: "dentification of the protease cleavage sites in a reconstituted Gag polyprotein of an HERV-K(HML-2) element" doc

... proteins previously identified by specific antisera. Fractions 43 to 46 gave two major bands migrating with apparent molecular masses of 15 kDa and approximately 18 kDa as wel l as an additional weaker ... mass spectra were visualized and processed using FlexAnalysis software and sequence tag hints were obtained by ana- lyzing tandem MS spectra employing the Biotools 3.0 software (Bruke...

Ngày tải lên: 13/08/2014, 01:20

15 374 0
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT 399 AKR6 YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT 400 1E YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT ... phosphate-buff- ered saline. Endogenous alkaline phosphatase was inacti- vated by incubating the cells at 68°C for 1 h. Cells...

Ngày tải lên: 13/08/2014, 09:21

12 227 0
Báo cáo y học: "Simultaneous sleep study and nasoendoscopic investigation in a patient with obstructive sleep apnoea syndrome refractory to continuous positive airway pressure: a case report" ppt

Báo cáo y học: "Simultaneous sleep study and nasoendoscopic investigation in a patient with obstructive sleep apnoea syndrome refractory to continuous positive airway pressure: a case report" ppt

... specifically bi-maxillary surgery, is also effective in severe cases of OSAS. It may be considered for patients who are unwilling to use, or are refractory to, nC PAP therapy and whose anatomical changes ... physical exam revealed macroglossia, a bulky soft palate and uvula. He was overweightwithabodymassindex(BMI )of2 9.1and had a cervical perimeter of 42 cm. As an initial dia...

Ngày tải lên: 11/08/2014, 14:21

7 359 1
Báo cáo y học: " Identification of arthritis-related gene clusters by microarray analysis of two independent mouse models for rheumatoid arthritis" pdf

Báo cáo y học: " Identification of arthritis-related gene clusters by microarray analysis of two independent mouse models for rheumatoid arthritis" pdf

... M, Yoshida E, Takiguchi M, Sato K, Kitajima I, Nishioka K, Yamamoto K, Takeda T, Hatanaka M, et al.: Induction of inflammatory arthropathy resembling rheumatoid arthritis in mice transgenic for ... HTLV-I and HTLV- II Volume 2. New York: Plenum Press; 1993. 7. Iwakura Y, Saijo S, Kioka Y, Nakayama-Yamada J, Itagaki K, Tosu M, Asano M, Kanai Y, Kakimoto K: Autoimmunity induction by...

Ngày tải lên: 09/08/2014, 08:22

13 363 0
Từ khóa:
w