Báo cáo khoa học: "The long and difficult road to better evaluation of outcomes of prolonged mechanical ventilation: not yet a highway to heave" pdf
... hospitals had received MV for at least 21 days. Commentary The long and difficult road to better evaluation of outcomes of prolonged mechanical ventilation: not yet a highway to heaven Alain Combes 1,2 1 Service ... functional status. However, predic- tors of mortality and long- term functional outcomes that are reliable and accurate at the level...
Ngày tải lên: 13/08/2014, 03:20
... from anti-inflammatory, to immunomodulatory, antibacte- rial, antifungal and antiviral functions [1]. SLPI and elafin ⁄ trappin-2 both have antimicrobial activity against Gram-negative and Gram-positive bacteria. SLPI ... influenzae, Streptococcus pneumoniae, Klebsiella pneumoniae, Branhamella catarrhalis and the pathogenic fungi A. fumigatus and C. albicans. Our results indicate th...
Ngày tải lên: 18/02/2014, 17:20
... Spirochaeta aurantia LGL B are either branched or unsaturated. Values stated a re the average n molÆmg )1 with standard deviations (±) obtained from quantifying and averaging areas under specific peaks ... brennabo- rense,andT. maltophilum appear to have functional similarity to LPS in that t hey possess some ability to gel Limulus amebocyte lysate (LAL) [12,20], a standard assay f...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: The diacylglycerol and protein kinase C pathways are not involved in insulin signalling in primary rat hepatocytes doc
... contrast, the available data on hepatic systems are scarce, controversial and have been obtained using primary adult rat hepatocyte suspensions and cultures, and different hepatoma cell lines, as model ... that the activation of glycogen Fig. 2. Modulation of basal and insulin-stimulated glycogen synthesis by epidermal growth factor (EGF), transforming growth factor a (TGF -a) ,...
Ngày tải lên: 20/02/2014, 02:21
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... comprise Cytc_Ddes Cytc_Dgig NrfH_Wsuc NrfH_Sdel NrfH_Ddes CymA_Sput NapC_Rsph NapC_Ppan NapC_Abra NapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... high molecular mass bands (not shown). Such electrophoretic behavior suggests that the bands at appr...
Ngày tải lên: 21/02/2014, 00:20
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf
... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e the evaluate.on ... so+lYe a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall proo...
Ngày tải lên: 21/02/2014, 20:20
Báo cáo khoa học: The chaperone and potential mannan-binding lectin (MBL) co-receptor calreticulin interacts with MBL through the binding site for MBL-associated serine proteases pdf
... generally accepted that the MASPs are activated upon binding of MBL to its targets and that this initi- ates activation of the complement cascade, leading to target lysis and/ or opsonization. Inactivation ... G, Gal P, Kojima M, Szilagyi K, Balczer J, Antal J, Graf L, Laich A, Moffatt BE, Schwaeble W et al. (2003) Natural substrates and inhibitors of man- nan-binding lectin-a...
Ngày tải lên: 07/03/2014, 05:20
Báo cáo khoa học: "THE MACHINE AND THE MAN" pot
... designer and creator of the machine; but let us not be so demanding as to say that he must create the machine and the translation system in its final form before the switch is thrown and the machine ... availability of mechanical translations of the most important foreign scientific and cul- tural writings is bound to have a great effect upon international commun...
Ngày tải lên: 16/03/2014, 19:20
Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot
... grammatical formalism for transportable natural language processing, llm~r. J. Cow~p~t~zt~na~ L~n~ist~cs, to appear. Biermann, A. and Ballard, B. Toward natural language computation. Am~r. ... portable natural language data base interface. Cmlf. on Ap'1)lied Nc~t~ral L~znguage Processing, Santa Munica, Ca., 1983, pp. 25-30. 25. Grosz, B. TEAM: A transportable natural l...
Ngày tải lên: 17/03/2014, 19:21
Báo cáo khoa học: "The Formal and Processing Models of CLG" docx
... and (b) the intermediate and final data structure are also partial descriptions, being potentially annotated with unresolved constraints, and denote not a single, but a class of representations. ... is no guarantee that all constraints will always be solved, not even after the last rewrite to normal lotto. As a result (a) the system does not fail because all const...
Ngày tải lên: 18/03/2014, 02:20