Báo cáo y học: "Anti-class a scavenger receptor autoantibodi

Báo cáo y học: "Anti-class a scavenger receptor autoantibodies from systemic lupus erythematosus patients impair phagocytic clearance of apoptotic cells by macrophages in vitro" doc

... Ren Y, Tang J, Mok MY, Chan AW, Wu A, Lau CS: Increased apoptotic neutrophils and macrophages and impaired macrophage phagocytic clearance of apoptotic neutrophils in systemic lupus erythematosus. Arthritis ... apoptosis and impaired phagocytic clearance of apoptotic cells could play important roles in the break- down of self-tolerance in autoimmune disea...

Ngày tải lên : 12/08/2014, 15:22

9
398
0

Báo cáo y học: "B lymphocyte stimulator (BLyS) isoforms in systemic lupus erythematosus: disease activity correlates better with blood leukocyte BLyS mRNA levels than with plasma BLyS protein levels" ppsx

... 5'-GCAGACAGTGAAACACCAACTATAC-3'; ∆BLyS sense 5'-CAGAAGAAACAGGATCTTACACAT-3'; and full- length BLyS/∆BLyS anti-sense 5'-TGCCAGCTGAATAG- CAGGAATTAT-3'. A 165 bp amplicon ... in normal individuals, and RA, and SLE patients. (a) Plasma from normal individuals (Nl), and RA and SLE patients were assayed for BLyS levels by ELISA. Each symbol indicates an ind...

Ngày tải lên : 09/08/2014, 07:20

12
350
0

Báo cáo y học: "DAS28: a useful instrument to monitor infliximab treatment in patients with rheumatoid arthritis" pps

... high and low disease activity to study the validity of the Disease Activity Score and the DAS28. In a study performed in Italy in the late 1990s, it was found that the Disease Activity Score was ... 35) of a sample of clinical profiles that were categorised into remission, low disease activity, moderate disease activity and high disease activity [7]. Interestingly, the cut-off...

Ngày tải lên : 09/08/2014, 07:20

2
371
0

Báo cáo y học: "Apigenin, a non-mutagenic dietary flavonoid, suppresses lupus by inhibiting autoantigen presentation for expansion of autoreactive Th1 and Th17 cells" potx

... autoreactive Th1 and Th17 cells and B cells in lupus. Apigenin also causes apoptosis of hyperactive lupus APCs and T and B cells, probably by inhibiting expression of NF- B-regulated anti -apoptotic ... peroxida- tion and antioxidant defense against hepatocarcinogenesis in Wistar albino rats. Phytomedicine 2004, 11:309-314. 24. Wang IK, Lin-Shiau SY, Lin JK: Induction of...

Ngày tải lên : 09/08/2014, 14:20

13
287
0

Báo cáo y học: " REFLEX, a social-cognitive group treatment to improve insight in schizophrenia: study protocol of a multi-center RCT" pptx

... functioning by combin- ing errorless learning (by using tasks varying from extremely easy to easy), immediate feedback, and tar- geted reinforcement to enhance flexibility, working memory, and planning. ... R, David AS: A comparative study of insight scales and their relationship to psychopathological and clinical variables. Psychological Medicine: A Journal of Research in Psyc...

Ngày tải lên : 11/08/2014, 16:20

9
511
0

Báo cáo y học: " Pruritus: a useful sign for predicting the haemodynamic changes that occur following administration of vancomycin" ppsx

... was transient, disappearing 15 min later. The reduction in systemic vascular resistance was not accompanied by a significant decrease in systemic arterial pressure, and because heart rate was ... protection against the anaphylactoid reactions that are mediated by release of histamine. Competing interests None declared. References 1. Fekety R: Vancomycin and teicoplanin. In P...

Ngày tải lên : 12/08/2014, 18:21

6
260
0

Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...

Ngày tải lên : 14/08/2014, 16:21

11
467
0

Báo cáo y học: " Multiple functions for CD28 and cytotoxic T lymphocyte antigen-4 during different phases of T cell responses: implications for arthritis and autoimmune disease" pot

... stopped by CTLA-4 from proliferating just to be eliminated by apoptosis, which would happen anyway by AICD. We observed that resistance to AICD is mediated by CTLA-4 on already activated Th cells. This ... Tokunaga K: Lack of a strong associ- ation of CTLA-4 exon 1 polymorphism with the susceptibility to rheumatoid arthritis and systemic lupus erythematosus in Japanes...

Ngày tải lên : 09/08/2014, 01:23

10
393
0

Báo cáo y học: " Adding 5-hydroxytryptamine receptor type 3 antagonists may reduce drug-induced nausea in poor insight obsessive-compulsive patients taking off-label doses of selective serotonin reuptake inhibitors: a 52-week follow-up case report" potx

... mg/day mirtazapine and 10 mg/day olanzapine. Fornaro and Martino Annals of General Psychiatry 2010, 9:39 http://www.annals-general-psychiatry.com/content/9/1/39 Page 3 of 4 CASE REPO R T Open Access Adding ... the patient was treated by a psychiatrist with alternative trials of SSRIs, including paroxetine 50 mg/day and sertraline 200 mg/day. TCAs such as clomi- pramine 300 mg/day pl...

Ngày tải lên : 09/08/2014, 01:21

4
313
0

Báo cáo y học: "Direct Toll-like receptor 2 mediated co-stimulation of T cells in the mouse system as a basis for chronic inflammatory joint disease" ppsx

... Freeman GJ: The B7-CD28 superfamily. Nat Rev Immunol 2002, 2:116-126. 20. Matsuyama T, Yamada A, Kay J, Yamada KM, Akiyama SK, Schlossman SF, Morimoto C: Activation of CD4 cells by fibronectin and ... isolated by FACS (MoFlo; Cytomation). The purity of the cells was greater than 99%. Generation of cytotoxic T lymphocyte lines (mixed lymphocyte culture) Generation of primary...

Ngày tải lên : 09/08/2014, 01:23

14
505
0