Báo cáo khoa học: " Comparative analysis between a low pathogenic and a high pathogenic influenza H5 hemagglutinin in cell entry" pptx

Báo cáo khoa học: " Comparative analysis between a low pathogenic and a high pathogenic influenza H5 hemagglutinin in cell entry" pptx

Báo cáo khoa học: " Comparative analysis between a low pathogenic and a high pathogenic influenza H5 hemagglutinin in cell entry" pptx

... uncleaved low pathogenic H5N2 HA USDA and high pathogenic H5N1 HA Qinghai (QH). Amnio acids implicated in cleavage of HA 0 into HA 1 and HA 2 are highlighted in red. HA.QH 1 -MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCD ... and a pcDNA3.1 plasmid carrying the appropriate HA gene. Producer cells Sequence alignment of uncleaved low pathogenic H5N2 HA...

Ngày tải lên: 12/08/2014, 04:21

5 156 0
Báo cáo khoa học: Comparative analysis of the site-specific N-glycosylation of human lactoferrin produced in maize and tobacco plants pdf

Báo cáo khoa học: Comparative analysis of the site-specific N-glycosylation of human lactoferrin produced in maize and tobacco plants pdf

... iron-binding protein that has been found to possess antibacterial, antifungal, antiviral, antineoplastic and anti -in ammatory activity and is considered as a novel therapeutic with broad spectrum potential ... glycosylation patterns of plant and mammalian cells can represent a limitation for the produc- tion of some recombinant therapeutic glycoproteins of mammalian origin in tra...

Ngày tải lên: 31/03/2014, 07:20

8 427 0
Báo cáo khoa học: "Comparative analysis of Panicum streak virus and Maize streak virus diversity, recombination patterns and phylogeography" pptx

Báo cáo khoa học: "Comparative analysis of Panicum streak virus and Maize streak virus diversity, recombination patterns and phylogeography" pptx

... Journal Open Access Research Comparative analysis of Panicum streak virus and Maize streak virus diversity, recombination patterns and phylogeography Arvind Varsani 1,2 , Aderito L Monjane 3 , Lara ... Cicadulina and have geographical ranges that are apparently restricted to Africa and its neighboring islands [1-7]. Whereas African streak virus species such as Eragrostis streak v...

Ngày tải lên: 12/08/2014, 04:20

11 286 0
báo cáo khoa học: " Comparative analysis of expressed sequence tags (ESTs) between drought-tolerant and -susceptible genotypes of chickpea under terminal drought stress" pot

báo cáo khoa học: " Comparative analysis of expressed sequence tags (ESTs) between drought-tolerant and -susceptible genotypes of chickpea under terminal drought stress" pot

... blot and real time PCR experiments. AAD, NLR and RV were involved in bioinformatics analysis. AAD, RS and RV analyzed the experiments. AAD and RS prepared the manuscript. All authors read and approved ... Siddique KHM, Brinsmead RB, Knight R, Knights EJ, Paul JG, Rose IA: Adaptation of chickpea (Cicer arietinum L.) and faba bean (Vicia faba L.) to Australia. In Linking resear...

Ngày tải lên: 11/08/2014, 11:22

20 829 0
Báo cáo khoa học: Comparative analysis of carbohydrate-binding properties of two tandem repeat-type Jacalin-related lectins, Castanea crenata agglutinin and Cycas revoluta leaf lectin docx

Báo cáo khoa học: Comparative analysis of carbohydrate-binding properties of two tandem repeat-type Jacalin-related lectins, Castanea crenata agglutinin and Cycas revoluta leaf lectin docx

... tandem repeat-type Jacalin-related lectins, Castanea crenata agglutinin and Cycas revoluta leaf lectin Sachiko Nakamura 1 , Fumio Yagi 2 , Kiichiro Totani 3 , Yukishige Ito 3 and Jun Hirabayashi 1 1 ... salt-stressed rice (Oryza sativa) plants. Planta 210, 970–978. 13 Hirano K, Teraoka T, Yamanaka H, Harashima A, Kunisaki A, Takahashi H & Hosokawa D (2000) Novel mannose-binding ric...

Ngày tải lên: 30/03/2014, 16:20

16 357 0
Báo cáo khoa học: "Comparative studies of the water relations and the hydraulic characteristics in Fraxinus excelsior, Acer pseudoplatanus and A. opalus trees under soil water contrasted conditions Damien Lemoinea, Jean-Paul Peltierb and Gérard" pdf

Báo cáo khoa học: "Comparative studies of the water relations and the hydraulic characteristics in Fraxinus excelsior, Acer pseudoplatanus and A. opalus trees under soil water contrasted conditions Damien Lemoinea, Jean-Paul Peltierb and Gérard" pdf

... full capacity of the water conducting vessels. At this stage, some free water ap- pears at the stomata level. The leaf was then fixed on a plate of an analytical balance and the water flow was in- duced ... water relations and the hydraulic characteristics in Fraxinus excelsior, Acer pseudoplatanus and A. opalus trees under soil water contrasted conditions Damien Lemoine a , Je...

Ngày tải lên: 08/08/2014, 14:21

10 341 0
Báo cáo khoa hoc:"Comparative analysis on the structural features of the 5 flanking region of κ-casein genes from six different species" pot

Báo cáo khoa hoc:"Comparative analysis on the structural features of the 5 flanking region of κ-casein genes from six different species" pot

... CTA TTCTGAGAA ATA −931: TGG TTCCCAGAA ACA −949: TCA TTCCAAGAA ACA PMF[13] ATCAN{0,8}TGAT −679: TAA ATCAGAATGAT CTG −726: GTG TGATCTAAATCA CAA TGATN{0,8}ATCA −597: AAG TGATTATTCATCA ATC −1405: AAC ... TTGAGGAAT ACA Rev: −298: TAT TTTAGCAAT AAC −1781: AAC CTTACCGAA GGA −214: ATT TTTAGAAAG CAC −1592: AAC ATTTCCCAA CAA Rev: −1577: AAC ATTTCCTCA TTT −481: TAA CTTACAAAACGC −639: TAT ATTACTGAA TTT −...

Ngày tải lên: 09/08/2014, 18:21

12 430 0
báo cáo khoa học: "Comparative analysis of root transcriptome profiles of two pairs of drought-tolerant and susceptible rice near-isogenic lines under different drought stress" doc

báo cáo khoa học: "Comparative analysis of root transcriptome profiles of two pairs of drought-tolerant and susceptible rice near-isogenic lines under different drought stress" doc

... calcineurin B-like protein-interacting protein kinases (CIPKs), calmodulin (CML) and calmodulin-related calcium sensor proteins, and receptor-like cytoplasmic kinases (RLCKs) were both up and ... and signalling pathways available in different databases and in the literature. A detailed comparison of different NILs for DEGs in different functional categories is shown in...

Ngày tải lên: 11/08/2014, 11:21

50 371 0
báo cáo khoa học: " Comparative analysis of slot dimension in lingual bracket systems" pps

báo cáo khoa học: " Comparative analysis of slot dimension in lingual bracket systems" pps

... appliance during orthodontic treatment, the labio-lingual inclination of maxillary and mandibular incisors and canines is considered by patients and orthodontists to be an important determinant ... bracket, variations of manufacturing processes including milling and casting of brackets, as well as clini- cal procedures like mode of ligation [13,14]. Furthermore, a patient's ind...

Ngày tải lên: 11/08/2014, 20:20

5 326 0
Từ khóa:
w