Báo cáo khoa học: " The genome and proteome of a virulent Escherichia coli O157:H7 bacteriophage closely resembling Salmonella phage Felix O1" doc
Báo cáo khoa học: " The genome and proteome of a virulent Escherichia coli O157:H7 bacteriophage closely resembling Salmonella phage Felix O1" doc
... contributions RA originally isolated phage V8. AMK assisted in the annotation and prepared the manuscript, EJL and SO propagated and purified the phage, and together with YMS contributed to the proteome analysis. ... of a virulent Escherichia coli O157:H7 bacteriophage closely resembling Salmonella phage Felix O1 Andre Villegas 1 , Yi-Min She 2 , A...
Ngày tải lên: 12/08/2014, 04:21
Báo cáo hóa học: " The genome and proteome of the Kluyvera bacteriophage Kvp1 – another member of the T7-like Autographivirinae" docx
... Dryden DT, Atanasiu C, Dornan J, Bruce S, Cronshaw A, et al.: Crystallization and preliminary X-ray analysis of ocr, the product of gene 0.3 of bacteriophage T7. Acta Crystallo- graphica Section ... (23.1%) and 9 (18.4%) homologs with the type phages of the three Comparison of the genomes of Yersinia phage Berlin and Kluyvera phage Kvp1 using MauveFigure 1 Com...
Ngày tải lên: 20/06/2014, 01:20
Báo cáo khoa học: "The Safety and efficacy of a new self-expandable intratracheal nitinol stent for the tracheal collapse in dogs" ppt
... located from the mid-cervical to the thoracic trachea increased the diameter of the entire cervical to thoracic tracheal area. Coughing and dyspnea disappeared and the dogs resumed normal activity. ... JA. Evaluation of the Palmaz stent in the trachea and mainstem bronchi of normal dogs. Vet Surg 1997, 26, 99-107. 13. Sasano S, Onuki T, Adachi T, Oyama K, Ikeda T...
Ngày tải lên: 07/08/2014, 20:23
báo cáo khoa học: " The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial" docx
... design, analysis of data, interpretation of data, and revision of the manuscript. Furthermore, all authors have approved the manuscript in its final version Acknowledgements The authors wish to thank ... and DVD duplication costs, and staff time spent sending the mailings (Table 1). We did not include staff time devoted to making the phone calls as this was considered pa...
Ngày tải lên: 11/08/2014, 16:21
báo cáo khoa học: " The isolation and mapping of a novel hydroxycinnamoyltransferase in the globe artichoke chlorogenic acid pathway" pptx
... GGGTTTCATATGACTATCGGAGCTCGTGAT HQT-Rev CGGGATCCCTAGAAGTCATACAAGCATTT HCT-ForRT TTTTTAAGCTAACACGAGAC HCT-RevRT TCTCATAGGAGCTGTAATTG HQT-ForRT TAAAATGGACGATCAGTATC HQT-RevRT TTATGTTCAGATTTGGACTC ACT-ForRT TACTTTCTACAACGAGCTTC ACT-RevRT ... CACGTCGGCTTCGACTGTAGGTCGACT HCT-OuterFor CACGAGACCAAGTCAATGCACTCAAAGGA HCT-OuterRev GATTCGGGCACTTAAACGTATGAGCCCC HQT-InnerFor CGTGGACTATCAGACGATCAACCATCC HQT...
Ngày tải lên: 12/08/2014, 03:20
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... comprise Cytc_Ddes Cytc_Dgig NrfH_Wsuc NrfH_Sdel NrfH_Ddes CymA_Sput NapC_Rsph NapC_Ppan NapC_Abra NapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... hemes are all in a low-spin state (S ¼ 1/2). One of them has a g max at 3.55, characteristic o...
Ngày tải lên: 21/02/2014, 00:20
Tài liệu Báo cáo khoa học: Purification and characterization of a sialic acid specific lectin from the hemolymph of the freshwater crab Paratelphusa jacquemontii pdf
... animal glycoconjugate. They act as an important component of the ligands recognized by the lectins. Recognition can be affected by specific structural variations and modifications of sialic acids and ... contain 4-O-Ac-NeuAc [43], and rabbit erythrocytes, which contain 9-O-Ac-NeuAc [41], showed maximum haemagglutination. On the other hand, human blood cells A, B and O [44,45]...
Ngày tải lên: 21/02/2014, 00:20
Tài liệu Báo cáo khoa học: Purification and characterization of a membrane-bound enzyme complex from the sulfate-reducing archaeon Archaeoglobus fulgidus related to heterodisulfide reductase from methanogenic archaea pdf
... with an apparent molecular mass of 53 kDa appears as a double band in unboiled samples (lanes A1 and B1). Table 1. N-Terminal sequences of the polypeptides of the purified enzyme. N-Terminal sequen ... FEBS 2002 absorption maxima at 420 nm (c band), 530 nm (b band) and 557 nm (a band) are characteristic of cytochrome b. Heme was extracted from the protein with acidic acet...
Ngày tải lên: 21/02/2014, 03:20
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf
... a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall prooeaoLng). There ere ... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e t...
Ngày tải lên: 21/02/2014, 20:20
Báo cáo khoa học: Identification and characterization of a nuclear receptor subfamily I member in the Platyhelminth Schistosoma mansoni (SmNR1) pot
... DR2: 5¢-CCGTAAGGTCACAAGGTCACTCG-3¢,DR3:5¢-CCG TAAGGTCACAGAGGTCACTCG-3¢, DR4: 5¢-CCGTAA GGTCACAGGAGGTCACTCG-3¢, DR5: 5¢-CCGTAAGG TCACCAGGAGGTCACTCG-3¢. PAL0: 5¢-CGCAAGGT CATGACCTCG-3¢. One strand of each oligonucleotide was annealed after ... bp was produced by PCR amplification with TOPO 2.1-SmNR1 as a template (forward primer: 5¢-ATTTCAGAAGTTGAAC AAACACAC-3¢, reverse primer: 5¢-AAGATGGTAT...
Ngày tải lên: 07/03/2014, 11:20