Báo cáo y học: " Origin of measles virus: divergence from rinderpest virus between the 11th and 12th centuries" pptx
Báo cáo y học: " Origin of measles virus: divergence from rinderpest virus between the 11th and 12th centuries" pptx
... . Virology Journal 2010, 7:52http://www.virologyj.com/content/7/1/52Page 2 of 4SHORT REPOR T Open Access Origin of measles virus: divergence from rinderpest virus between the 11th and 12thcenturiesYuki ... evolutionary rate of 6.0 - 6.5 × 10-4substitutions/site/year. It was concluded that the divergence time of the most recent common ancestor of current MeV was the early 20thcentury. And, divergence between ... mortality. Many diseases arecaused by viruses originating in non-human species[26]: HIV from non-human primates [27]; SARS corona- virus from bats [28]; and the pandemic strain of influ-enza virus...
- 4
- 405
- 0
Báo cáo y học: " Identification of a novel linear B-cell epitope in the UL26 and UL26.5 proteins of Duck Enteritis Virus" doc
... be520IYYPGE525,because any deletion of residues from either end of 520IYYPGE525destroyed the ability of mAb 1C8 to bin d.Comparative analysis of the amino acid sequences of the identified ... DQDEPDA DYPYYPGEARGA PRGVDS GRDEPDR DFPYYPGEARPE PRPVDS DYDDRD DAPYYPGEARAP PRVVPDSGGRGRDHDDRD DAAYYPGEARAP RFAPDSAG RDRSIESD LYYPGEFRRSNFSPPQASSMKYEETDKSPEQE PYYPGEFQQS EHRNLRCEDGDKYDEPD ... DEV and HSV-1 [36,39]. The sequence of the epitope is indicated by the yellow bars. Each of the proteins isdesignated by UL26 or UL26.5 plus the sites of cleavage. The pinkbars represent the...
- 9
- 450
- 0
Báo cáo y học: " Effect of Ankaferd Blood Stopper on air leakage in the lung and prevention of bleeding: an experimental study" ppsx
... Abantİzzet Baysal, Bolu, Turkey.2Department of Pediatric Surgery, School of Medicine, University of Abant İ zzet Baysal, Bolu, Turkey.3Department of Emergency, School of Medicine, University of Abant ... pneumonectomy [11]. The focus of hemorrhagecannot be determined in most of the cases. In the study of Sirbu et al. analyzing 1960 patients who underwentthoracotomy, they detected t hat the most ... İzzet Baysal, Bolu,Turkey.4Department of Thoracic Surgery, School of Medicine, University of Karaelmas, Zonguldak, Turkey.5Department of pathology, School of Medicine, University of Abant...
- 5
- 487
- 0
Báo cáo y học: "Influence of enrollment sequence effect on observed outcomes in the ADDRESS and PROWESS studies of drotrecogin alfa (activated) in patients with severe sepsis" pptx
... the observedoutcomes. We report the results of these analyses and addi-tional exploratory analyses of both the PROWESS and ADDRESS databases. We discuss the results of these analy-ses in the ... Lilly and Company. WLM, JJ, MDW, and DRN are employees and stockholders of Eli Lilly and Company.Authors' contributionsP-FL and EA participated in the conception and design of the study, ... in the development and conduct of analyses, and in the clinical trials and data collection. WLM, JJ, and DRN partici-pated in the conception and design of the study, in the devel-opment and...
- 13
- 341
- 0
Báo cáo y học: "Characterization of an H3N2 triple reassortant influenza virus with a mutation at the receptor binding domain (D190A) that occurred upon virus transmission from turkeys to pigs" potx
... out the experiments and wrote the manuscript. MK generated the pig and turkey epithelial cells and helped in the infection studies. HMY, CWL, and YMS designed the experiments and analyzed the ... differently interms of transmission between swine and turkeys [10].Only one virus (A/turkey/Ohio/313053/04) transmittedefficiently both ways between swine and turkeys.Another virus (A/turkey/North ... way from pigs to turkeys but not vice verse. Neither of other two viruses (A/t urkey/I llinois/04 and A/ swine/North Carolina/03) transmitted either way between the two species. One of these viruses,...
- 7
- 512
- 0
Báo cáo y học: " Association of ABO blood groups with Chikungunya virus Short report" doc
... writing the manuscript. RVV hasdone the statistical analysis and interpretation of the results. DVRSG partici-pated in the design and coordination of the study, analysis of the data and drafting of ... disease [16]. The difference in the asso-ciation of the blood groups and CHIKV infection of the present study to that of the previously documentedreport emphasizes the necessity of carrying out ... its victims by the end of 2006 and whichfurther declined to an estimated 59,535, 95,091 and 68,245 cases by the end of 2007, 2008 and 2009, respec-tively [8,9]. Andhra Pradesh, the most affected...
- 6
- 260
- 0
Báo cáo y học: " Lack of evidence for xenotropic murine leukemia virus-related virus(XMRV) in German prostate cancer patients" pdf
... microscope.ResultsDetermination of the RNaseL genotype of prostate cancer samples The highly significant correlation between XMRV-positiveprostate cancers and homozygosity for the QQ allel of the RNaseL SNP ... possibly suggests that the ratherrestricted geographic incidence of XMRV infections, and the epidemiology of XMRV in the United States shouldtherefore be studied closely. In addition, the oncogenicpotential ... carcinomacells originally derived from a primary prostatic carci-noma [17]. This observation further highlights the need toclarify the participation of XMRV in the etiology of humanprostate...
- 11
- 226
- 0
Báo cáo y học: "Mechanisms of leukemogenesis induced by bovine leukemia virus: prospects for novel anti-retroviral therapies in human" pot
... p24) and regulatory proteins (Tax and Rex) are synthesized at high titers. Some of these antibod-ies are directly lytic for BLV-producing cells [314]. The level of antibody-mediated cytolytic ... identify a large domainwithin the provirus that is dispensable for infectivity invivo. Indeed, the deletion of the region which expands from the end of the env gene to the splice acceptor site of the ... purposes)Structure of the BLV provirus: genes, RNA transcripts and viral proteinFigure 2Structure of the BLV provirus: genes, RNA transcripts and viral protein. The provirus is flanked by two identical...
- 32
- 335
- 0
Báo cáo y học: " Origin of the blood hyperserotonemia of autism Skirmantas Janušonis" pps
... overproduction of 5-HTby tryptophan hydroxylase and an excessive loss of presy-naptic 5-HT due to its reduced uptake by SERT. If the former is the case, the activity of trypotophan hydroxylaseshould ... the ith compartment of the G-system, μi> 0, and Σiμi = 1. Thenwhere is the mean of the steady-state concentrations of free 5-HT in the compartments of the G-system:We have already ... plate-let) and Km ≈ 0.60 · 10-6 mol/L (these values wereobtained by weighting the medians of each of the threegroups of [18] by the number of subjects in the study).Plugging these values and the...
- 16
- 212
- 0
Báo cáo y học: "Origin of nascent lineages and the mechanisms used to prime second-strand DNA synthesis in the R1 and R2 retrotransposons of Drosophila" doc
... divergedby 4.7% in their 5' UTRs and 3.6% in their 3' UTRs, similar to the divergence between the R2 elements of D. melanogaster and D. simulans. The amino acid divergence of the ORF from the ... as the divergence from the consensus sequence for the species. Grey bars indicate the rates of nucleotide divergence (percent divergence per million years (myr)) of these same regions. Standard ... nucleotides of the cDNA are proposed to anneal to the top strand of the cleaved target site. This microhomology allows precise priming of second-strand DNA synthesis and the generation of the precise...
- 17
- 240
- 0
Từ khóa: báo cáo y họcbáo cáo y học cổ truyềnmẫu báo cáo y học cổ truyềnbao cao y hoc colchicinphan ban luan trong bao cao y hoc co truyenbáo cáo khoa học y họcbáo cáo y tế học đườngmẫu báo cáo y tế học đườngbáo cáo y tế học đường cuối nămbáo cáo y tế học đường năm 2012báo cáo y tế học đường trường mầm nonbiểu mẫu báo cáo y tế trường họcbáo cáo y tế học đường trường tiểu họcbáo cáo y tế trường tiểu họcbáo cáo y tế trường học năm 2012chuyên đề điện xoay chiều theo dạngNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinChuong 2 nhận dạng rui roTranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ