báo cáo khoa học: " A newly-developed community microarray resource for transcriptome profiling in Brassica species enables the confirmation of Brassica-specific expressed sequences" pdf

... prepared the RNA. EKL participated in the design of the microarray, helped formulate the exper- imental design and the drafting of the manuscript. PH participated in the design of the microarray. ... level [19]. Therefore some types of microarrays designed for use in A. thaliana can be used for the analysis in Brassica of the related genes. Howev...

Ngày tải lên: 12/08/2014, 03:20

... attachment, and a flag indicating if their concatenation is a goal hypothesis. The beam search maintains state for each deriva- tion, the score of which is a linear combination of the feature values. States ... English-Arabic translation as an example of a translation direction that expresses substantially more morphological information in the target. These relations...

Ngày tải lên: 16/03/2014, 19:20

... 13-1 Takara-machi, Kanazawa, 920-8641, Japan. 5 Division of Cardiology, Department of Internal Medicine, Graduate School of Medical Science, Kanazawa University, 13-1 Takara-machi, Kanazawa, 920- 8641, ... Science, Kanazawa Univ ersit, 13-1 Takara-machi, Kanazawa, 920-8641, Japan Full list of author information is available at the end of the article Demura et al. Journal of Me...

Ngày tải lên: 11/08/2014, 02:22

... testing. To obtain a stable informational value, this partitioning, training, and testing was performed in terms of 500 differ- ent realizations. As a result, we obtained a classification accuracy of 95 ... par- titioned into a training subset and a disjoint test subset [25]. We randomly partitioned the data set and used one half for training the classifier and the oth...

Ngày tải lên: 12/08/2014, 05:20

... metadata in Bioconductor. To compare the phenanthrene microarray data with published microarray data, Affymetrix ATH1 .CEL files were obtained from the AffyWatch service of the Not- tingham Arabidopsis ... many remaining questions surround PAH stress, the microarray data provide a number of leads for improving PAH phytoremediation. Relaxing the rate- and capacity-lim...

Ngày tải lên: 12/08/2014, 03:21

... b-cryptoxanthin [10]. The zeaxanthin produced by CYP17 5A1 is used as an inter- mediate for the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMG...

Ngày tải lên: 18/02/2014, 08:20

... among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans (formerly known as A. oxydans). ... o-dianisidine (Sigma) and 10 lgÆmL )1 of MABO. The reaction was initiated by the addition of substrate, and the increase in absorption at 430 nm caused by the oxidation...

Ngày tải lên: 19/02/2014, 16:20

... Learning a ranking directly, rather than fitting a classifier score to a grade point scale after training, is both a more generic approach to the task and one which exploits the labelling information ... principal advantage of applying rank prefer- ence learning to the AA task is that we explicitly 182 Proceedings of the 49th Annual Meeting of the Association for Compu...

Ngày tải lên: 20/02/2014, 04:20

... violation or matching. By employing these features, we can investigate the value of various syntactic con- straints in phrase translation. 317 Proceedings of the 47th Annual Meeting of the ACL and the ... maintains and protects the strength of the phrase-based approach in a better way than the CMVC does. It is able to reward non-syntactic translations by assign- in...

Ngày tải lên: 20/02/2014, 07:20

... is the fact that there is often a good deal of overlap in words between the reparandum and the alteration, as speakers may trace back several words when restarting after an er- ror. For instance, ... modified for use in a special repair grammar, which not only reduces the amount of available training data, but violates our intuition that most reparanda are fluent up unti...

Ngày tải lên: 20/02/2014, 09:20