Báo cáo y học: "Identification of Pns6, a putative movement protein of RRSV, as a silencing suppressor" pdf

... have also adopted this strategy as a way forward in molecular analysis. Alagaratnam et al are utilising Bayesian approaches to pursue muscular dystro- phy diagnosis [223]. Similarly, the example ... questionnaires and other arbitrary measures for disease classification. Adopting a systems biology approach, whereby a disease defining molecular fingerprint is analysed, would increase th...

Ngày tải lên: 12/08/2014, 14:20

... instead of spontaneous hypothermia, as a result of hypothalamic damage [10].  is study may also help explain some recent clinical observations. In particular, it was recently shown that early ... Acute Physiology and Chronic Health Evaluation; CA, cardiac arrest; SOFA, Sequential Organ Failure Assessment; TH, therapeutic hypothermia. Competing interests The authors declare that t...

Ngày tải lên: 13/08/2014, 21:21

... reaction was analysed directly by SDS-PAGE, a further aliquot was digested with 0.3 mg/ml proteinase K (Boehringer Mannheim, Mannheim, Ger- many) for 10 minutes at 25°C and a third aliquot was treated with ... 33:1361-1370. 15. Love LA, Leff RL, Fraser DD, Targoff IN, Dalakas M, Plotz PH, Miller FW: A new approach to the classification of idiopathic inflam- matory myopathy: myositis-s...

Ngày tải lên: 09/08/2014, 07:20

... resulting in large areas of monolayer breakdown (Figure 2C). Cellu- lar cytotoxicity was measured by MTT assays, and chro- mosomal DNA fragmentation analysis was employed to determine gross apoptotic ... characterized LASV VLP-associated GP1 and GP2 glycosylation patterns. Glyc oprotein 1 associated with VLP generated essentially the same glycosylation pattern as sGP1, with only partial d...

Ngày tải lên: 12/08/2014, 01:22

... [2]. Hyal2 is a member of a family of proteins, some of which exhibit high hyaluronidase activity and are capable of rapid degrada- tion of hyaluronan, a component of the extracellular matrix. ... LWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPTYSR 303 Human LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR 300 Mouse LWAESTALFPSVYLDETLASSVHSRNFVSFRVREAL...

Ngày tải lên: 13/08/2014, 09:21

... day three that only partly responded to treatment with bensodiazepines. After eight days in the ICU, he was transferred to an ordi- nary ward and eventually to a rehabilitation facility. He was ... glassy oedema. Still, the patient improved and at normothermia, sedation was reduced. Two and a half days after the accident he regained con- sciousness and could respond adequately, and was .....

Ngày tải lên: 13/08/2014, 23:20

... 142:1719-1726. 9. Upadhyaya NM, Zinkowsky E, Kositratana W, Waterhouse PM: The Mr 43K major capsid protein of rice ragged stunt Oryzavirus is a post- translationally processed product of a Mr 67,348 polypeptide ... respectively (Figure 1). Transformed agrobac- terial strain carrying each of these constructs was mixed with a strain that carried 35S-GFP with a ratio of 3:1 and...

Ngày tải lên: 12/08/2014, 02:20

... of the anti-SmD3 peptide (SMP) assayAssay performance characteristics of the anti-SmD3 peptide (SMP) assay. (a) Intra-assay and interassay variability, (b) linearity, and (c) receiver operating ... (Rheumaklinik Aachen, Aachen, Germany), Prof. Dr MJ Fritzler (University of Calgary, Calgary, Canada) and by Labor Limbach (Heidelberg, Germany). To assess further the assay specificity, we...

Ngày tải lên: 09/08/2014, 06:22

... pathophysiology of endothelial cells, and antibody to endothelial cell antigen (AECA) has been reported. Reports on the prevalence of AECA have varied largely and alpha-eno- lase was reported as ... 1). The 120 kDa antigen was also shown to migrate differently from alanyl tRNA synthetase in another Western blot analysis (data not shown) and did not share any apparent crossreactive epito...

Ngày tải lên: 09/08/2014, 07:20

... rheumatoid arthritis. J Rheumatol 1994, 21:1027-1033. 20. Nakashima K, Hagiwara T, Ishigami A, Nagata S, Asaga H, Kuramoto M, Senshu T, Yamada M: Molecular characterization of peptidylarginine deiminase ... Hanagiri T, Yasumoto K: [Tumor marker in primary lung cancer]. J UOEH 2004, 26:473-479. 38. Suzuki A, Yamada R, Chang X, Tokuhiro S, Sawada T, Suzuki M, Nagasaki M, Nakayama-Hamada M,...

Ngày tải lên: 09/08/2014, 07:20