Báo cáo y học: " Influenza A virus NS1 gene mutations F103L and M106I increase replication and virulence" potx
Báo cáo y học: " Influenza A virus NS1 gene mutations F103L and M106I increase replication and virulence" potx
... show that the F103L and M106I NS1 gene mutations ar e adap- tive and control IAV replication and virulence. Materials and methods Cells and viruses Madin-Darbycaninekidney(MDCK)cells,human embryonic ... at days 1, 2, 3, 5 and 7 post infection. Organs were sonicated on ice and viral titer was assessed by plaque assay. Values are shown as averages +/- standard deviatio...
Ngày tải lên: 11/08/2014, 21:21
Báo cáo y học: " Influenza C virus NS1 protein counteracts RIG-I-mediated IFN signalling" potx
... 76:11166-71. 19. Alamgir AS, Matsuzaki Y, Hongo S, Tsuchiya E, Sugawara K, Muraki Y, Nakamura K: Phylogenetic analysis of influenza C virus nonstructural (NS) protein genes and identification of the ... Pachler K, Mayr J, Vlasak R: A seven plasmid-based system for rescue of influenza C virus. J Mol Genet Med 2010, 4:239-246. 21. Muraki Y, Furukawa T, Kohno Y, Matsuzaki Y, Tak...
Ngày tải lên: 11/08/2014, 21:22
Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf
... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...
Ngày tải lên: 14/08/2014, 16:21
Báo cáo y học: " Influenza A viral loads in respiratory samples collected from patients infected with pandemic H1N1, seasonal H1N1 and H3N2 viruses" pdf
... Muramoto Y, Tamura D, Sakai-Tagawa Y, Noda T, Sakabe S, Imai M, Hatta Y, Watanabe S, Li C, Yamada S, Fujii K, Murakami S, Imai H, Kakugawa S, Ito M, Takano R, Received: 28 January 2010 Accepted: ... Goto H, Takahashi K, Makino A, Ishigaki H, Nakayama M, Okamatsu M, Takahashi K, Warshauer D, Shult PA, Saito R, Suzuki H, Furuta Y, Yamashita M, Mitamura K, Nakano K, Nakamura M, Brockm...
Ngày tải lên: 12/08/2014, 04:20
Báo cáo y học: " Influenza H5N1 virus infection of polarized human alveolar epithelial cells and lung microvascular endothelial cells" pdf
... infection. Aa = apical release after apical infection, Ab = basolateral release after apical infection, Ba = apical release after basolateral infection, Bb = basolateral release after basolateral infection. ... apical infection, Ab = basolateral release after apical infection, Ba = apical release after basolateral infection, Bb = basolateral release after basolateral infection. Single and...
Ngày tải lên: 12/08/2014, 14:20
Báo cáo y học: "Terameprocol, a methylated derivative of nordihydroguaiaretic acid, inhibits production of prostaglandins and several key inflammatory cytokines and chemokines" ppsx
... 5' ATG TCA GAT CCA CAA CGG ATA GAT 3'; sense: 5' ACT CCC TCA AGA TTG TCA GCA AT 3']; TNF-α [antisense: 5' AGA AGA GGC ACT CCC CCA AAA 3'; sense: 5' CCG AAG ... CGG ACA CCA 3'; antisense: 5' CTA GCT CAT CTC CAA ATA GTT GAT 3']; COX-2: [sense: 5' GCA TTC TTT GCC CAG CAC TT 3'; antisense: 5' AGA CCA GGC ACC AGA CCA AAG A 3']...
Ngày tải lên: 11/08/2014, 08:22
Báo cáo y học: "Complete suppression of viral gene expression is associated with the onset and progression of lymphoid malignancy: observations in Bovine Leukemia Virus-infected sheep" pdf
... Okayama A, Matsuoka M: Silencing of human T-cell leukemia virus type I gene transcription by epigenetic mechanisms. Retrovirology 2005, 2:64. 28. Kamoi K, Yamamoto K, Misawa A, Miyake A, Ishida ... T, Tanaka Y, Mochizuki M, Watanabe T: SUV39H1 interacts with HTLV-1 Tax and abrogates Tax transactivation of HTLV-1 LTR. Ret- rovirology 2006, 3:5. 29. Sagata N, Yasunaga T, Tsuzuku-Kaw...
Ngày tải lên: 13/08/2014, 05:22
Báo cáo y học: "An atlas of bovine gene expression reveals novel distinctive tissue characteristics and evidence for improving genome annotation" pot
... The integrity of the RNA was confirmed by a 2100 Bioanaly- zer and RNA 6000 Nano-chip (Agilent, Santa Clara, CA, USA). The samples used had an average RNA integrity number (RIN) value of 8.0 and a 28S:18 ... Siddiqui AS, Khattra J, Delaney AD, Zhao Y, Astell C, Asano J, Babakaiff R, Barber S, Beland J, Bohacec S, Brown-John M, Chand S, Charest D, Charters AM, Cullum R, Dhalla N, Feat...
Ngày tải lên: 09/08/2014, 22:23
Báo cáo y học: "Three novel beta-galactosidase gene mutations in Han Chinese patients with GM1 gangliosidosis are correlated with disease severity" ppsx
... F: ACCACTTGTCCACAGCTGCCAGGTAATCTGGGTCGGAGG R: CTGGCAGCTGTGGACAAGTGGTTGGGAGTCCT—GCCCAAGATGAAGCCTC c.902C>T p.Ala301Val 8 F: AAGTATATCATAGAGGGAGGAAGCCAC TGCTTCGGTCTTG R: TTCCTCCCTCTATGATATACTTGCCCGTGGGGTGAGTGTGAACTTGTACATG c.1481G>T ... TTCCTCCCTCTATGATATACTTGCCCGTGGGGTGAGTGTGAACTTGTACATG c.1481G>T p.Gly494Val 15 F: GTTGATATATGCACCATAGTTCACACGTCCCATGTTCTC R: GAACTATGGTGCATATATCAACGATTT...
Ngày tải lên: 10/08/2014, 05:21
Báo cáo y học: " The Chinese version of the Obsessive-Compulsive Inventory-Revised scale: Replication and extension to non-clinical and clinical individuals with OCD symptoms" pps
... cited. patients with OCD, anxiety disorders, and depressive disorders. Journal of Anxiety Disorders 2008, 22:734-749. 17. American Psychiatric Association: Diagnostic and Statistical Manual of Mental ... Key Laboratory of Mental Health, Institute of Psychology, Chinese Academy of Sciences, Beijing, China Full list of author information is available at the end of the article Peng et al. BM...
Ngày tải lên: 11/08/2014, 15:22