Báo cáo y học: " A rapid method to screen putative mRNA targets of any known microRNA" pdf

Báo cáo y học: " A rapid method to screen putative mRNA targets of any known microRNA" pdf

Báo cáo y học: " A rapid method to screen putative mRNA targets of any known microRNA" pdf

... F:5’-GGACTAGTAGGCCTTTCACAACTAGGACTGA R:5’-CCCAAGCTTAAACTGCAAATAGTCGTTACAAA Homo sapiens transportin 1 F:5’-GGACTAGTTCTAATACACTTAAGCTGCAGT R:5’-CCCAAGCTTGCTTCTTCACATCCACTGCGGAGT Homo sapiens ribosomal ... sapiens mRNA for putative NFkB activating protein F:5’-GGACTAGTTGAACACAGAAAGTCTAAGAGGA R:5’-CCCAAGCTTGCTAATTAAACTTTGATTTTATTATG HCMV UL17/18 F:5’-GGACTAGTTACCAGCGGTTACGCACCGAG R:5’-CCCAAG...

Ngày tải lên: 11/08/2014, 21:21

8 365 0
Báo cáo y học: "A computational method to predict genetically encoded rare amino acids in proteins" pdf

Báo cáo y học: "A computational method to predict genetically encoded rare amino acids in proteins" pdf

... VGSPELGLISASVAKLAQFYGLPAFVAGT FGTPEPALGSLVMGQLARRLNMPLRCAGNFSTSKAPDGQAMQ FGTPEHFTASLVAGQLARRIGLPWRCAG-GSAANINDAQAAN FGTPEASLVTYGAGQLARRLGLPFRSAGSFCGSKLPDAQAAY FGTPENAKANIIAGQLARRYKLPYRTSN-ANASNAVDLQAAY GGSGEQALLTAGCAQMHQFYRLPGGAAAGIADAKLPDMQAGW FGTPEPSLVSYGAAQLARRLGLPFRTGGSLCGSKVPDAQAAH GGGGEQAILMAGAAQMGRRWDLPTSSIAGITDAKRLDAQYGA GGSGEQALLTAGCAQMHRFYDLPGGAAAGIADSKLPDMQAGW FGTPEYMRATQMTGQMARF...

Ngày tải lên: 14/08/2014, 14:22

15 288 0
Báo cáo y học: "A novel method to identify and characterise peptide mimotopes of heat shock protein 70-associated antigens" pptx

Báo cáo y học: "A novel method to identify and characterise peptide mimotopes of heat shock protein 70-associated antigens" pptx

... Therapies and Vaccines Open Access Original research A novel method to identify and characterise peptide mimotopes of heat shock protein 70-associated antigens Blanca Arnaiz 1 , Laura Madrigal-Estebas 2 , ... Testori A, Rivoltini L, Maio M, Andreola G, Sertoli MR, Gallino G, Piris A, Cattelan A, Lazzari I, Carrabba M, Scita G, Santantonio C, Pilla L, Tragni G, Lombardo C, Arienti...

Ngày tải lên: 11/08/2014, 10:23

12 501 0
Báo cáo toán học: "A New Method to Construct Lower Bounds for Van der Waerden Numbers" pdf

Báo cáo toán học: "A New Method to Construct Lower Bounds for Van der Waerden Numbers" pdf

... Theory and Applications of Satisfiability Testing. pages 143-157, 2005 [12] B.M. Landman and A. Robertson, Ramsey Theory on the Integers (Student Mathe- matical Library, V. 24) American Mathematical ... n} of the partition. The transformation involved is called a circular translation. Cyclic certificates have the favorable property that they can be repeatedly appended to create larger...

Ngày tải lên: 07/08/2014, 15:22

18 401 0
Báo cáo y học: " A Practical Approach to Managing Patients with HCV Infection"

Báo cáo y học: " A Practical Approach to Managing Patients with HCV Infection"

... histology, the ratio of aspartate aminotransferase (AST) to alanine aminotransferase (ALT) >1 is a dependable marker for cirrhosis [28,29]. Increased INR and thrombocytopenia is also seen ... use, former history of transfusion of blood products, unexplained history of abnormal liver transaminases, or a known history of contact exposure to HCV. The clinical history...

Ngày tải lên: 02/11/2012, 09:51

6 533 0
Báo cáo y học: "A Practical Approach to Management of Chronic Hepatitis B"

Báo cáo y học: "A Practical Approach to Management of Chronic Hepatitis B"

... persistently normal transaminases. ALT Levels For many years, ALT has been used as a standard surrogate for the activity of CHB. Thus, ALT level in combination with HBV DNA level and histological activity ... Divisions of Gastroenterology and Transplantation, University of California, Irvine, California, USA. His current researches include natural history and management of hepa...

Ngày tải lên: 03/11/2012, 09:41

7 542 0
Báo cáo y học: "An innovative method to evaluate the suture compliance in sealing the surgical wound lip"

Báo cáo y học: "An innovative method to evaluate the suture compliance in sealing the surgical wound lip"

... taken of the suture threads until the re- maining stain (if any) dried. Such photos were then analyzed to measure the surface stain area using an image analysis system (IAS). We chose the above ... Corporation; Tokyo, Ja- pan), an image analysis processor (Matrox; Montreal, QC, Canada), and a personal computer (Pentium 2, 166-MHZ processor; Intel; Santa Clara, CA). Clinical study...

Ngày tải lên: 03/11/2012, 11:52

7 603 0
báo cáo hóa học:" A rapid method for the generation of uniform acellular bone explants: a technical note" pot

báo cáo hóa học:" A rapid method for the generation of uniform acellular bone explants: a technical note" pot

... data analysis and the preparation of the manuscript. MJS supervised the study plan- ning, data analysis and preparation of the manuscript. All authors read and approved the final manuscript. Acknowledgements The ... in a hypotonic solution (salt-free water) and a short cycle of repeated freezing and thawing. Results: Viability of treated and 2 days cultured bone explants was inve...

Ngày tải lên: 20/06/2014, 04:20

4 403 0
Báo cáo hóa học: " A Novel Method to Fabricate Silicon Nanowire p–n Junctions by a Combination of Ion Implantation and in-situ Doping" docx

Báo cáo hóa học: " A Novel Method to Fabricate Silicon Nanowire p–n Junctions by a Combination of Ion Implantation and in-situ Doping" docx

... characteristics and ideality factors close to 2. We think that this value of ideality factors arises out of a high rate of carrier recombination through surface states in the native oxide covering the nanowires. Keywords ... leaving any residual structural defects in them. Separately, we have also demonstrated in-situ doping of molecular beam epitaxy (MBE)-grown Si NWs [13]. S....

Ngày tải lên: 22/06/2014, 00:20

4 332 0
Báo cáo hóa học: "A Simple Method to Synthesize Cadmium Hydroxide Nanobelts" pptx

Báo cáo hóa học: "A Simple Method to Synthesize Cadmium Hydroxide Nanobelts" pptx

... with absolute ethanol and distilled water for several times, and then dried in vacuum at 40 8C for 4 h. X-ray diffraction (XRD) patterns were carried out on a Japan Rigaku D/max rA X-ray diffractometer ... diffusion of ions in glycol is more rapid than in other polyol, such as glycerine and diethylene glycol; this leads to acceleration in the solubility of starting materials and in...

Ngày tải lên: 22/06/2014, 01:20

5 371 0
Từ khóa:
w