... transition in the DNA ligase catalysis? DYNAMIC MECHANISM OF NICK RECOGNITION BY DNA LIGASE – AHYPOTHESIS According to Doherty et al. [25,34], the adenylylated DNA ligase binds dsDNA forming nonspecific ... proposed mechanism of dynamic nick recognition by DNA ligase. (Left) binding of the dsDNA. (Right) binding of the nicked dsDNA. B-form DNA is c...
Ngày tải lên: 21/02/2014, 01:21
... four allophycocyanins and phycocyanins, HPLC separation allowed a quantitative estimation of the relative amount of each protein component from the area underlying each peak. This was facilitated ... indicates the peak a ffected. Fig. 3. Characterization of linker proteins. RP-HPLC of sucrose band 1analyzedonlinewithanESImassspectrometer.Theseparation conditions are indicated...
Ngày tải lên: 08/03/2014, 16:20
Báo cáo Y học: Solution structure of the HIV gp120 C5 Domain pptx
... that HIV C5 directly interacts with the HIV gp41 ectodomain in the presence of cosolvent, suggesting that the C5 structure presented herein is physiologically relevant. The HIV gp120 C5 structure ... interaction between the gp120 C1 and C5 domains and the gp41 loop region. In an effort to further characterize the gp41 /gp120 interaction, the solution...
Ngày tải lên: 08/03/2014, 16:20
Báo cáo Y học: Conformational analysis of opacity proteins from Neisseria meningitidis ppt
... partial characterization of the opacity- associated proteins of Neisseria gonorrhoeae. J. Exp. Med. 159, 452–462. 28. Stern, A., Brown, M., Nickel, P. & Meyer, T.F. (1986) Opacity genes in Neisseria gonorrhoeae: ... recep- tor. Conformational analysis of the purified, refolded proteins provided the first experimental evidence for a secondary structure dominated by b-str...
Ngày tải lên: 17/03/2014, 10:20
Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt
... randalld@missouri.edu Abbreviations: AtPDK, Arabidopsis thaliana pyruvate dehydrogenase kinase; BCKDK, branched-chain a-ketoacid dehydrogenase kinase; E1, pyruvate dehydrogenase; kd-PDC, kinase- depleted pyruvate dehydrogenase ... LAGYGYGLPLSRLYAR IK+SD GGG+ R+ L RIFTY+YSTA P +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLG...
Ngày tải lên: 31/03/2014, 15:20
Báo cáo Y học: Kinetic studies of human tyrosyl-DNA phosphodiesterase, an enzyme in the topoisomerase I DNA repair pathway pot
... understand the enzymatic mechanism of this novel enzyme, and to facilitate inhibitor screening of human TDP, we have expressed and purified recombinant human TDP variants carrying deletions of 1–39 ... human TDP variants was approximated to be 5 mgặL )1 of E. coli culture (Fig. 2). TDP is involved in the Topo I DNA repair pathway, and inhibitors of TDP may have th...
Ngày tải lên: 31/03/2014, 21:21
Báo cáo y học: "Primary glomangiosarcoma of the lung: A case report" ppt
... followed by glomangioma. Gloman- giomyoma is the rarest variant with a frequency as low as 8% of a ll glomus tumours [4]. Glom us tumors are highly vascular, and are usually solitary, caused by a proliferation ... care of the patient and contributed equally in carrying out the medical literature search and preparation of the manuscript. AN and AB were responsible for the...
Ngày tải lên: 10/08/2014, 09:22
Báo cáo y học: "Endoscopic management of biliary fascioliasis: a case report" ppt
... report Rajan F Ezzat * , Taha A Karboli, Kalandar A Kasnazani, Adnan MH Hamawandi Abstract Introduction: Fasciola hepatica, an endemic parasite common in Iraq and its neighboring countries, is a very ... cholangiopancreatography is available, the disease can be easily diagnosed and treated. Introduction Fasciola hepatica (FH) is a leaf-shaped trematode t hat usually attacks cattle and...
Ngày tải lên: 11/08/2014, 12:20
Báo cáo y học: "Simulation studies of age-specific lifetime major depression prevalence" ppt
... Reliability of a lifetime history of major depression: implications for heritability and co-morbidity. Psychol Med 1998, 28:4857-870. 21. Patten SB: Simulation of a Possible Major Depression ... SB: Simulation of Age-specific Lifetime Prevalence of Major Depression. Calgary, DSpace at University of Calgary 2009 [https://dspace. ucalgary.ca/handle/1880/47429]. 20. F...
Ngày tải lên: 11/08/2014, 16:22
Báo cáo y học: "The course of untreated anxiety and depression, and determinants of poor one-year outcome: a one-year cohort study" ppt
... the PNCQ has not specifically been validated, a study comparing PNCQ data from an Australian and a Dutch sample of primary care patients with anxiety and/ or depression, showed many similari- ties ... youngest participant being 18 years of age and the oldest 65. Participants had an average of 12.0 years (sd. 3.4 years) of education, ranging from 5 to 18 years. The majorit...
Ngày tải lên: 11/08/2014, 16:22
Báo cáo y học: " Diagnostic properties of metabolic perturbations in rheumatoid arthritis" pptx
... way of identi- fying the potential role o f metabolic profiling within the field of rheumatology. One of the fields that has driven the development of metabolic profiling is systems biology, in ... complete picture of the findings. Selection of the most discrimina- tory metabolites would almost certainly be required before using a metabolic marker profile in a clinical s...
Ngày tải lên: 12/08/2014, 15:22
Báo cáo y học: "Mutagenesis analysis of the zinc-finger antiviral protein" ppt
... impor- tant for the antiviral activity of ZAP [7,9,10]. The results are summarized in table 1. Figure 2 The activity of the ZAP mutants to bind the target RNA. The lysates of Rat2 cells expressing the indicated ... to understand how the activity of these mutants was affected, they were further analyzed for their interaction with the target RNA, the exosome, and...
Ngày tải lên: 12/08/2014, 23:23
Báo cáo y học: " Genotypic prediction of HIV-1 subtype D tropism" pptx
... 0.10. Table 4 Comparison of genotypic prediction of HIV tropism and the observed phenotype on a GenBank data set of HIV-1 subtype D viruses Phenotype Concordance Genotypic Prediction Genotypic tool R5 R5X4/X4 ... 3 Genotypic prediction of HIV-1 tropism by a subtype D specific algorithm compared to the observed phenotype TTT Concordance Genotypic Prediction...
Ngày tải lên: 13/08/2014, 01:21
Báo cáo y học: " Kinetic studies of HIV-1 and HIV-2 envelope glycoprotein-mediated fusion" potx
... serum, 60 mg/ml of penicillin and 100 mg/ml streptomycin. Sup-T1 cells Sequence comparison of HIV-1 and HIV-2 EnvsFigure 4 Sequence comparison of HIV-1 and HIV-2 Envs. The HIV-1 subtype B infectious ... this analysis by comparing only one HIV-1 and two HIV-2 strains we believe that the methodology developed here can be expanded to include comparisons between variou...
Ngày tải lên: 13/08/2014, 09:20
Báo cáo y học: "Genomic studies of mood disorders - the brain as a muscle" pot
... Physical therapy may become a useful supplement to pharmacotherapy and psychotherapy, with a treadmill supplanting the proverbial Freudian couch. The Romans may have had it right with their ideal of mens ... Central Ltd An evolutionary perspective on mood disorders Mood - the way one feels inside emotionally - is likely to have evolved, broadly speaking, as a se...
Ngày tải lên: 14/08/2014, 14:21