Báo cáo y học: " Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses" docx

Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf

Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf

... Pseudomonas aeruginosa. Although many plant family 19 chitinases are known, crystal structures are available for only two of these [9,15–17]. The first structure of a bacterial family 19 chitinase has ... T, Yokokawa S, Saito A, Fujii T, Nikaidou N, Miyashita K & Watanabe T (2006) Comparison of enzymatic and antifungal properties between family 18 and...
Ngày tải lên : 07/03/2014, 11:20
  • 12
  • 399
  • 0
Báo cáo Y học: Purification and characterization of VanXYC, a D,D-dipeptidase/D,D-carboxypeptidase in vancomycin-resistant Enterococcus gallinarum BM4174 docx

Báo cáo Y học: Purification and characterization of VanXYC, a D,D-dipeptidase/D,D-carboxypeptidase in vancomycin-resistant Enterococcus gallinarum BM4174 docx

... polymerase (Stratagene) was used to amplify vanXY C usingpAT704as template with primers A (5Â-GCTA GGTCTCAATGAAC ACATTACAATT-3Â)andB(5Â-TATG GAATTCTCATG CGAACTGCCTCA-3Â) that included BsaIandEcoRI restriction ... molecular mass standards; lane 2, cytoplasm containing MBP-VanXY C ;Lane3,MBP–VanXY C after amylose resin chroma- tography. (C) Purification of His 6 –VanXY C . Lane 1, molecula...
Ngày tải lên : 18/03/2014, 01:20
  • 7
  • 414
  • 0
Báo cáo Y học: Purification and catalytic properties of a CO-oxidizing:H2-evolving enzyme complex from Carboxydothermus hydrogenoformans doc

Báo cáo Y học: Purification and catalytic properties of a CO-oxidizing:H2-evolving enzyme complex from Carboxydothermus hydrogenoformans doc

... the purification and catalytic proper- ties of a membrane-bound enzyme complex from C. hydro- genoformans composed of a hydrogenase and a CO dehydrogenases. The complex catalyzes the conversion of CO ... Fe-containing catalytic subunit of CO dehydrogenase. A catalytically active CooSI dimer has been previously purified and characterized from C. hydrogenofo...
Ngày tải lên : 23/03/2014, 21:20
  • 10
  • 376
  • 0
Báo cáo Y học: Heterologous expression and folding analysis of a b-tubulin isotype from the Antarctic ciliate Euplotes focardii ppt

Báo cáo Y học: Heterologous expression and folding analysis of a b-tubulin isotype from the Antarctic ciliate Euplotes focardii ppt

... expression and folding analysis of a b-tubulin isotype from the Antarctic ciliate Euplotes focardii Sandra Pucciarelli 1,2 , Cristina Miceli 1 and Ronald Melki 2 1 Dipartimento di Biologia Molecolare, ... eukaryotes, an isotype of b-tubulin (b-T1) from the Antarctic ciliate Euplotes focardii, was expressed in Escherichia coli. Folding analysis...
Ngày tải lên : 23/03/2014, 21:20
  • 7
  • 500
  • 0
Báo cáo Y học: Chemical structure and immunoreactivity of the lipopolysaccharide of the deep rough mutant I-69 Rd–/b+ of Haemophilus influenzae docx

Báo cáo Y học: Chemical structure and immunoreactivity of the lipopolysaccharide of the deep rough mutant I-69 Rd–/b+ of Haemophilus influenzae docx

... ể FEBS 2002 Chemical structure and immunoreactivity of the lipopolysaccharide of the deep rough mutant I-69 Rd /b + of Haemophilus inuenzae Sven Muă ller-Loennies, Lore Brade and Helmut Brade Research ... Medicine and Biosciences, Borstel, Germany From the lipopolysaccharide of the deep rough mutant I-69 Rd – /b + of Haemophilus influenz...
Ngày tải lên : 31/03/2014, 21:21
  • 6
  • 372
  • 0
Báo cáo y học: " Phosphatidylserine receptor and apoptosis: consequences of a non-ingested meal" pptx

Báo cáo y học: " Phosphatidylserine receptor and apoptosis: consequences of a non-ingested meal" pptx

... hypotheses. Disposing of dying cell: a fine balance between proinflammatory and anti-inflammatory signals Phagocytosis of apoptotic cells is known to be an anti- inflammatory [15] and immunologically silent ... that different phagocytic receptors may cooperate with each other and function as a team. Some receptors may simply play a role in tethering of phagocyte to apoptoti...
Ngày tải lên : 09/08/2014, 01:23
  • 4
  • 332
  • 0
Báo cáo y học: "ITGAV polymorphism and disease susceptibility in a Japanese rheumatoid arthritis population" ppsx

Báo cáo y học: "ITGAV polymorphism and disease susceptibility in a Japanese rheumatoid arthritis population" ppsx

... Inoue E, Toyama Y, Hara M, Yamanaka H, Tomatsu T, Momohara S, Kamatani N: Failure to confirm associ- ation between PDCD1 polymorphisms and rheumatoid arthri- tis in a Japanese population. J Hum Genet ... with rheumatoid arthritis in the European Caucasian population: a family-based study. Arthritis Res Ther 2007, 9:R63. 2. Friedlander M, Brooks PC, Shaffer RW, Kincaid CM,...
Ngày tải lên : 09/08/2014, 10:21
  • 2
  • 313
  • 0
Báo cáo y học: "Sleep structure and sleepiness in chronic fatigue syndrome with or without coexisting fibromyalgia" pdf

Báo cáo y học: "Sleep structure and sleepiness in chronic fatigue syndrome with or without coexisting fibromyalgia" pdf

... sleep structures and subjective scores on visual analog scales for sleepiness and fatigue in CFS patients with or without coexisting fibromyalgia (n = 12 and 14, respectively) with 26 healthy subjects. ... quality perception in the chronic fatigue syndrome: correlations with sleep efficiency, affective symptoms and intensity of fatigue. Neuropsychobiology 200...
Ngày tải lên : 09/08/2014, 10:23
  • 10
  • 454
  • 0
Báo cáo y học: "Biologic activity and safety of belimumab, a neutralizing anti-B-lymphocyte stimulator (BLyS) monoclonal antibody: a phase I trial in patients with systemic lupus erythematosus" potx

Báo cáo y học: "Biologic activity and safety of belimumab, a neutralizing anti-B-lymphocyte stimulator (BLyS) monoclonal antibody: a phase I trial in patients with systemic lupus erythematosus" potx

... study of belimumab in SLE patients with stable, mild to moderate disease activity and demonstrated its safety, biologic activity, and pharmacokinetics. Materials and methods Patients Patients aged ... work is properly cited. Abstract Introduction This trial evaluated the safety, biologic activity, and pharmacokinetics of belimumab, a fully human monoclonal an...
Ngày tải lên : 09/08/2014, 13:21
  • 15
  • 478
  • 0
Báo cáo y học: " De novo genome sequence assembly of a filamentous fungus using Sanger, 454 and Illumina sequence data" ppsx

Báo cáo y học: " De novo genome sequence assembly of a filamentous fungus using Sanger, 454 and Illumina sequence data" ppsx

... Forge assemblies were generated using Illumina, 454 and Sanger read data. The &apos ;454& apos; assembly was generated using only 454 SE read data. The 'Sanger -454& apos; assembly was generated ... combining Illumina, 454 and Sanger sequence data. Background The efficiency of de novo genome sequence assembly proc- esses depends heavily on the length, fo...
Ngày tải lên : 09/08/2014, 20:20
  • 12
  • 620
  • 0
Báo cáo y học: "HIV, appendectomy and postoperative complications at a reference hospital in Northwest Tanzania: cross-sectional study" doc

Báo cáo y học: "HIV, appendectomy and postoperative complications at a reference hospital in Northwest Tanzania: cross-sectional study" doc

... with append icitis in Tanzania, and are associated with severe morbidity, postoperative complications and longer hospital stays. Early diagnosis of appendicitis and prompt appendectomy are crucial ... referral centre for tertiary specialist care f or a catchment population of approximately 13 million people from Mwanza, Mara, Kagera, Shinyanga, Tabora and Kigoma regions of...
Ngày tải lên : 10/08/2014, 05:21
  • 6
  • 345
  • 0
Báo cáo y học: "Rationale, design and methodology for Intraventricular Pressure Gradients Study: a novel approach f" doc

Báo cáo y học: "Rationale, design and methodology for Intraventricular Pressure Gradients Study: a novel approach f" doc

... outflow-tract pressure gradient and apical and basal myocardial segments lengthening changes at basal, afterloaded and ischemic conditions. Afterload increase will be performed by abruptly narrowing ... pulmonary dis- ease that are worse than mild as assessed clinically and/ or confirmed by pulmonary function testing. (Table 1) The baseline and follow-up clinical variables and p...
Ngày tải lên : 10/08/2014, 09:21
  • 6
  • 377
  • 0
Báo cáo y học: " Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses" docx

Báo cáo y học: " Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses" docx

... 4 Family Structure and Posttraumatic Stress Reactions: A Longitudinal Study Using Multilevel Analyses Background There has been increasing interest in the relevance of family factors ... the article as it appeared upon acceptance. Fully formatted PDF and full text (HTML) versions will be made available soon. Family Structure and Posttraumatic Stress...
Ngày tải lên : 11/08/2014, 16:21
  • 28
  • 253
  • 0
Báo cáo y học: "PEEP titration guided by ventilation homogeneity: a feasibility study using electrical impedance tomography" ppt

Báo cáo y học: "PEEP titration guided by ventilation homogeneity: a feasibility study using electrical impedance tomography" ppt

... MP, Tanaka H, Sipmann FS, Santos DC, Barbas CS, Carvalho CR, Amato MB: Imbalances in regional lung ventilation: a validation study on electrical impedance tomography. Am J Respir Crit Care Med ... et al., PEEP titration guided by ventilation homoge- neity: a feasibility study using electrical impedance tomography Critical Care 2010, 14:R8 Zhao et al. Critical...
Ngày tải lên : 13/08/2014, 20:21
  • 8
  • 245
  • 0
Báo cáo y học: " Functions, structure, and read-through alternative splicing of feline APOBEC3 genes" ppt

Báo cáo y học: " Functions, structure, and read-through alternative splicing of feline APOBEC3 genes" ppt

... KVHPWARCHAEQCFLSWFRDQYPYRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS 120 A3Cb KVHPWARCHAEQCFLSWFRDQYPYRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS A3Cc KVHPWARCHAEQCFLSWFRDQYPCRDEYYNVTWFLSWSPCPTCAEEVVEFLEEYRNLTLS A3Ca IFTSRLYYFWDPNYQEGLCKLWDAGVQLDIMSCDDFKHCWDNFVDHKGMRFQRRNLLKDY ... 5 Expression analysis of feline A3C, A3H and A3CH. (a,b) Analysis of expression of feline A3C, A3H and A3CH by R...
Ngày tải lên : 14/08/2014, 08:20
  • 20
  • 264
  • 0

Xem thêm

Từ khóa: