báo cáo khoa học: " The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial" docx

báo cáo khoa học: " The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial" docx

báo cáo khoa học: " The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial" docx

... purposes) Implementation Science Open Access Research article The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial Carmen L Lewis* 1,2 , Alison T ... included a decision aid as a part of the intervention. We identified a randomized controlled trial performed by Zapka and colleagues that mailed...

Ngày tải lên: 11/08/2014, 16:21

8 269 0
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt

Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt

... comprise Cytc_Ddes Cytc_Dgig NrfH_Wsuc NrfH_Sdel NrfH_Ddes CymA_Sput NapC_Rsph NapC_Ppan NapC_Abra NapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... hemes are all in a low-spin state (S ¼ 1/2). One of them has a g max at 3.55, characteristic o...

Ngày tải lên: 21/02/2014, 00:20

12 594 0
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf

Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf

... a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall prooeaoLng). There ere ... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e t...

Ngày tải lên: 21/02/2014, 20:20

4 585 0
Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot

Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot

... grammatical formalism for transportable natural language processing, llm~r. J. Cow~p~t~zt~na~ L~n~ist~cs, to appear. Biermann, A. and Ballard, B. Toward natural language computation. Am~r. ... portable natural language data base interface. Cmlf. on Ap'1)lied Nc~t~ral L~znguage Processing, Santa Munica, Ca., 1983, pp. 25-30. 25. Grosz, B. TEAM: A transportable natural la...

Ngày tải lên: 17/03/2014, 19:21

5 453 0
Báo cáo khoa học:The isolation and characterization of temperature-dependent ricin A chain molecules in Saccharomyces cerevisiae docx

Báo cáo khoa học:The isolation and characterization of temperature-dependent ricin A chain molecules in Saccharomyces cerevisiae docx

... the mature ORF of RTA were CP172 5¢-ATATTCCCCAAACAATACCC-3¢ and the anti- sense primer CP133 5¢-TTAAAACTGTGACGATGGT GGA-3¢ with the TAA termination anticodon shown in bold. Amplification reactions ... by proteasomes in a tightly coupled process known as ER- associated degradation (ERAD). It appears likely that RTA (and other toxins that reach the ER lumen) may hi-jack components...

Ngày tải lên: 23/03/2014, 07:20

14 411 0
Báo cáo khoa học: The Yin and Yang of protein folding doc

Báo cáo khoa học: The Yin and Yang of protein folding doc

... that initiate the amyloid cascade. Especially in age-related amyloidosis, this may lead to the accumulation of large quantities of partially folded proteins and the saturation of the capacity of ... protofibrils, the latter having a characteristic ‘beaded’ appearance (Figs. 1 and 2). Whether these structures form on-pathway or are an off-pathway product of fibril forma...

Ngày tải lên: 23/03/2014, 11:20

9 460 0
Báo cáo khoa học: "The Acquisition and Application of Context Sensitive Grammar for English" docx

Báo cáo khoa học: "The Acquisition and Application of Context Sensitive Grammar for English" docx

... expressive approach, its many vari- ations have found much use in application to natural lan- guage applications and there is a broad literature on Aug- mented Phrase Structure Grammar [Gazdar et. al. ... Grammars." In Manaster-Ramer Ed.),Mathematics of Language, John Benjamins, msterdam, Netherlands, 1985. McClelland, J.L., and Kawamoto, A. H., "Mechanisms of Sent...

Ngày tải lên: 31/03/2014, 06:20

8 478 0
Báo cáo khoa học: "The detection and representation of ambiguities of intension and description" pptx

Báo cáo khoa học: "The detection and representation of ambiguities of intension and description" pptx

... since the filler of the role Queen of England is not likely to change within the time of the conversation and the speaker, the hearer, and Nadia are all aware of who fills that role, it is acceptable ... matches a particular descrip- tion, rather than towards that of owning a particular dog. 3Hofstadter, Clossman, and Meredith (1982) analyze a similar s...

Ngày tải lên: 31/03/2014, 17:20

8 304 0
Báo cáo khoa học: "The Safety and efficacy of a new self-expandable intratracheal nitinol stent for the tracheal collapse in dogs" ppt

Báo cáo khoa học: "The Safety and efficacy of a new self-expandable intratracheal nitinol stent for the tracheal collapse in dogs" ppt

... located from the mid-cervical to the thoracic trachea increased the diameter of the entire cervical to thoracic tracheal area. Coughing and dyspnea disappeared and the dogs resumed normal activity. ... JA. Evaluation of the Palmaz stent in the trachea and mainstem bronchi of normal dogs. Vet Surg 1997, 26, 99-107. 13. Sasano S, Onuki T, Adachi T, Oyama K, Ikeda T...

Ngày tải lên: 07/08/2014, 20:23

3 576 0
Báo cáo khoa học: "The expression and localization of inhibin isotypes in mouse testis during postnatal development" pdf

Báo cáo khoa học: "The expression and localization of inhibin isotypes in mouse testis during postnatal development" pdf

... high grade prostate cancer. J Clin Endocrinol Metab 1998, 83, 969-975. 15. Nagata S, Tsunoda N, Nagamine N, Tanaka Y, Taniyama H, Nambo Y, Watanabe G, Taya K. Testicular inhibin in the stallion: ... β A and β B and beta-actin (A) . Arrowheads indicate the positions of the inhibin isotype s (40∼47 kDa) and beta-actin (45 kDa). Minor bands at various molecular weights were...

Ngày tải lên: 07/08/2014, 23:22

5 283 0
Từ khóa:
w