báo cáo khoa học: " The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial" docx
báo cáo khoa học: " The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trial" docx
... purposes)Implementation ScienceOpen AccessResearch article The uptake and effect of a mailed multi-modal colon cancer screening intervention: A pilot controlled trialCarmen L Lewis*1,2, Alison T ... included a decision aid as a part of the intervention. We identified a randomized controlled trial performed by Zapka and colleagues that mailed a colon cancer screening educa-tional video to ... design, analysis of data,interpretation of data, and revision of the manuscript.Furthermore, all authors have approved the manuscript inits final versionAcknowledgements The authors wish to thank...
- 8
- 269
- 0
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... compriseCytc_DdesCytc_DgigNrfH_WsucNrfH_SdelNrfH_DdesCymA_SputNapC_RsphNapC_PpanNapC_AbraNapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... hemes are allin a low-spin state (S ¼ 1/2). One of them has a gmaxat 3.55,characteristic of bis-histidinyl iron ligands in a noncoplanararrangement, and has a positive reduction potential.Keywords: ... reductasesubunits (NrfA and NrfH) fromDesulfovibrio desulfuricansATCC 27774Re-evaluation of the spectroscopic data and redox propertiesMaria Gabriela Almeida1, So a Macieira2, Luisa L. Gonc¸alves1,...
- 12
- 593
- 0
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf
... a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall prooeaoLng). There ere ... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e the evaluate.on ... ~Ant about 5h ~a ~rt~e~ar example %8 5hat ~t %e embedded wlthAn an "el~mlnatAon of alternat£voo" arll~Nnt etruoture. The5 %a, 5hAm "prqitAo arluaent" 18 used 50 el~aAnaSe...
- 4
- 584
- 0
Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot
... grammatical formalism for transportable natural language processing, llm~r. J. Cow~p~t~zt~na~ L~n~ist~cs, to appear. Biermann, A. and Ballard, B. Toward natural language computation. Am~r. ... portable natural language data base interface. Cmlf. on Ap'1)lied Nc~t~ral L~znguage Processing, Santa Munica, Ca., 1983, pp. 25-30. 25. Grosz, B. TEAM: A transportable natural language ... meanings can be derived by the system from the meanings of other modifiers, rather than separately acquired from the user• For example, if the meaning of the adjective "large" has...
- 5
- 452
- 0
Báo cáo khoa học:The isolation and characterization of temperature-dependent ricin A chain molecules in Saccharomyces cerevisiae docx
... the mature ORF of RTA wereCP172 5¢-ATATTCCCCAAACAATACCC-3¢ and the anti-sense primer CP133 5¢-TTAAAACTGTGACGATGGTGGA-3¢ with the TAA termination anticodon shown inbold. Amplification reactions ... byproteasomes in a tightly coupled process known as ER-associated degradation (ERAD). It appears likely thatRTA (and other toxins that reach the ER lumen) mayhi-jack components of the ERAD pathway ... calculated by relating the amount of any rRNA frag-ment released upon aniline treatment with the amount of 5.8S rRNA (directly proportional to the quantity of 25S rRNA) and expressing values as...
- 14
- 411
- 0
Báo cáo khoa học: The Yin and Yang of protein folding doc
... that initiate the amyloidcascade. Especially in age-related amyloidosis, thismay lead to the accumulation of large quantities of partially folded proteins and the saturation of the capacity of ... protofibrils, the latter having a characteristic ‘beaded’ appearance (Figs. 1 and 2).Whether these structures form on-pathway or are anoff-pathway product of fibril formation, and which of these structures ... pro-teins that fold successfully to their native state and hence escape the cellular quality control machinery,random conformational fluctuations can lead to the transient formation of aggregation-prone...
- 9
- 460
- 0
Báo cáo khoa học: "The Acquisition and Application of Context Sensitive Grammar for English" docx
... expressive approach, its many vari- ations have found much use in application to natural lan- guage applications and there is a broad literature on Aug- mented Phrase Structure Grammar [Gazdar et. al. ... Grammars." In Manaster-Ramer Ed.),Mathematics of Language, John Benjamins, msterdam, Netherlands, 1985. McClelland, J.L., and Kawamoto, A. H., "Mechanisms of Sentence Processing: Assigning ... elements of the stack with pp to form the next state of the parse, Thus we create a windowed confexf of 10 symbols as the left half of a rule and an operation as the right half. Note that if the...
- 8
- 478
- 0
Báo cáo khoa học: "The detection and representation of ambiguities of intension and description" pptx
... since the filler of the role Queen of England is not likely to change within the time of the conversation and the speaker, the hearer, and Nadia are all aware of who fills that role, it is acceptable ... matches a particular descrip- tion, rather than towards that of owning a particular dog. 3Hofstadter, Clossman, and Meredith (1982) analyze a similar sen- tence for the case where the speaker and ... England is a lovely lady. (33) Nadia thinks that Queen Elizabeth is a lovely lady. (34) Nadia thinks that the titular head of the Church of England is a lovely lady. The assumption is that...
- 8
- 304
- 0
Báo cáo khoa học: "The Safety and efficacy of a new self-expandable intratracheal nitinol stent for the tracheal collapse in dogs" ppt
... located from the mid-cervical to the thoracic trachea increased the diameter of the entire cervical to thoracic tracheal area. Coughing and dyspnea disappeared and the dogs resumed normal activity. ... JA. Evaluation of the Palmaz stent in the trachea and mainstem bronchi of normal dogs. Vet Surg 1997, 26, 99-107.13. Sasano S, Onuki T, Adachi T, Oyama K, Ikeda T, Kanzaki M, Kuwata H, Sakuraba ... cervical trachea to thoracic trachea.Fig. 1. Lateral radiographs before (a) and after (b) intratracheal placement of self expandable nitinol stent with flare ends in a dog with tracheal collapse....
- 3
- 576
- 0
Báo cáo khoa học: "The expression and localization of inhibin isotypes in mouse testis during postnatal development" pdf
... high grade prostate cancer. J Clin Endocrinol Metab 1998, 83, 969-975. 15. Nagata S, Tsunoda N, Nagamine N, Tanaka Y, Taniyama H, Nambo Y, Watanabe G, Taya K. Testicular inhibin in the stallion: ... β A and βB and beta-actin (A) . Arrowheads indicate the positions of the inhibin isotypes(40∼47 kDa) and beta-actin (45 kDa). Minor bands at various molecular weights were detected on the ... in accordance with the National Research Council’s Guide for the Care and Use of Laboratory Animals (USA).Antisera Rabbit polyclonal anti-inhibin α (H-134), β A (H-120) and βB (H-110) antibodies...
- 5
- 283
- 0
Từ khóa: Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXChuong 2 nhận dạng rui roQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM