báo cáo khoa học: " The National Institute of Health Research (NIHR) Collaboration for Leadership in Applied Health Research and Care (CLAHRC) for Leicestershire, Northamptonshire and Rutland (LNR): a programme protocol" potx
báo cáo khoa học: " The National Institute of Health Research (NIHR) Collaboration for Leadership in Applied Health Research and Care (CLAHRC) for Leicestershire, Northamptonshire and Rutland (LNR): a programme protocol" potx
... obesity in pri- The translation model of National Institute for Health Research Collaboration for Leadership in Applied Health Research and Care for Leicestershire, Northamptonshire and Rutland (NIHR ... (NIHR CLAHRC for LNR)Figure 1 The translation model of National Institute for Health Research Collaboration for Leadership in Applied Health Research and Care for Leicester-shire, Northamptonshire ... Health Research and Care (CLAHRCs) are new organisationsfunded by the National Institute for Health Research (NIHR) in England to conduct and implement applied health research, the focus being on the...
- 5
- 375
- 0
Báo cáo y học: " The National Institute of Health Research (NIHR) Collaboration for Leadership in Applied Health Research and Care (CLAHRC) for Leicestershire, Northamptonshire and Rutland (LNR): a programme protocol" pdf
... Health Research and Care for Leicestershire, Northamptonshire and Rutland (NIHR CLAHRC for LNR)Figure 1 The translation model of National Institute for Health Research Collaboration for Leadership ... develop and investigate methods of translating research evidence into practice. Given the titleCollaborations for Leadership in Applied Health Research and Care (CLAHRC), all involve collaboration between ... underway, the first addressing the issue of implementation of guidelines on obesity in pri- The translation model of National Institute for Health Research Collaboration for Leadership in Applied Health...
- 5
- 385
- 0
Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx
... main chain at Glu268. The oxygen of the main chain at Asp266 was bound to amino groups of main chain of Tyr269 and Ala270 by hydrogen bonds. The interactions should maintain the structure of the ... 5¢-GCCATTTCCATAtTgaGTaCTGTTACCAAG-3¢ ScaID266N 5¢-CATACTCAGCgTtaACTAAGCCATTTC-3¢ HpaIY26 9A 5¢-TTGAGCCGCAgcCTCAGCgTCgAC TAAGCCATTTC-3¢ SalIQ272R 5¢-CTTAGGGATTAacGAGCCGCATACTCAGCgTCgAC TAAGCCATTTC-3¢ HpaID266N/Y26 9A ... GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQJ 211 GGTYGAYNGTSMATTHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQAMYL 211 GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQBPN' 211 GNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQMECE...
- 9
- 489
- 0
Báo cáo khoa học: The specificity of alcohol dehydrogenase with cis-retinoids Activity with 11-cis-retinol and localization in retina docx
... (underlined) for BamHI at the 5¢ end (5¢-CTATCGGATCCATGAGCACAGCAGGAAAAG-3¢)andforEcoRI at the 3¢ end (5¢-CCACTTGAATTCTCAAAACGTCAGGACGGT-3¢). Double digestion with BamHI and EcoRI allowed the ... all-trans-retinol and all-trans-ret-inal, and with the cis-isomers of retinol and retinal (7-cis-,9-cis-, 11-cis -and1 3-cis-), were determined for human and mouse ADH1 and ADH4 enzymes (Tables 2 and ... distance between the functionaloxygen atom and the catalytic Zn shorter than 3.16 A ˚.Moreover, the distance between the O atom of retinoids and the C4 of the nicotinamide ring, involved in the...
- 11
- 468
- 0
Báo cáo khoa học: "Tree-ring characteristics of subalpine fir (Abies lasiocarpa (Hook.) Nutt.) in relation to elevation and climatic fluctuations" docx
... University of British Columbia, for provid-ing a french translation of the abstract and title. The financial support provided by the Natural Science and Engineering Council of Canada, BC Ministry of Forests, and ... climate as the major determi-nant of tree growth, and the concerns about the impact of climatic change on forest growth, the aim of the presentstudy was to quantify the influence of local and ... negative-ly to August precipitation, indicating that latewood formation was favored by warm, sunny, and – therefore– relatively dry weather in August. In addition, LW and LW% showed a negative...
- 12
- 245
- 0
Báo cáo khoa học: "The clinical value of daily routine chest radiographs in a mixed medical–surgical intensive care unit is low"
... in the design and statistical analysis of the study. MS conceived and coordinated the study and wasinvolved in the interpretation of the data and manuscript revi-sion. All authors read and approved ... participated in analysis and interpretation of the data and in drafting the manuscript. PS, JS and MV contributed to the conception and design of the study and manuscript revision.JK was involved in ... University of Amsterdam, Amsterdam, The Netherlands3Resident, Departments of Intensive Care Medicine and Anesthesiology, Academic Medical Center, University of Amsterdam, Amsterdam, The Netherlands4Clinical...
- 7
- 722
- 0
Tài liệu Báo cáo khoa học: The central role of CDE/CHR promoter elements in the regulation of cell cycle-dependent gene transcription pdf
... NF-Y appears to form interactionsalso with other activating factors. The results of employing plasmid-based ChIP assays on the Cdc2promoter indicate that E2F3 binding to the distal acti-vating ... contrast, cyclin B1 and cyclin B2are central to the regulation of progress through the cell cycle (Fig. 1). Cyclins B1 and B2 appear in S phase and accumulate in G2 and mitosis before disappearingat ... composed of p130, E2F4 ⁄ 5 and DP1 ⁄ 2 and a module containing the MuvB proteins Lin-37, Lin-52, Lin-54 and chromatin-associated Lin-9 and Lin-53 ⁄ RBBP4 ⁄ RbAp48.Furthermore, A- Myb and B-Myb...
- 17
- 876
- 0
Tài liệu Báo cáo khoa học: The capsid protein of human immunodeficiency virus: intersubunit interactions during virus assembly doc
... The Gag subunits are radially extended, with the N-terminal domain, MA, associated with the innerlayer of the viral membrane, and the remainingdomains forming the innermost protein layers accor-ding ... spectroscopy. The N-terminal domain of CA (NTD) and the C-ter-minal domain of CA (CTD) are small, globular and mainly helical. NTD contains a- helices 1–7 of CA, and is connected by a flexible linker to CTD, ... conformational rear-rangements of CA during the assembly of both the immature and the mature capsid of HIV-1 and otherretroviruses. Induced conformational switching in CTD and ⁄ or NTD and...
- 12
- 577
- 0
Tài liệu Báo cáo khoa học: The capsid protein of human immunodeficiency virus: designing inhibitors of capsid assembly ppt
... Valenci-ana (ACOMP ⁄ 2009⁄ 185). Drs Mauricio G. Mateu and Francisco N. Barrera are thanked for critically reading the manuscript and for their collaboration over allthese years. Dr Anjali P. Mascarenhas ... Mascarenhas and ProfessorKarin Musier-Forsyth are thanked for critically read-ing and correcting an early version of the manuscript.Marı´ a del Carmen Lidon-Moya and Estefanı´ a Hurtado-Go´mez ... position in the protein. This movement creates a large cavity where the aromatic ring of CAP-1 inserts; the urea and dimethyla-monium groups of CAP-1 also make contacts with the side chains and ⁄...
- 8
- 593
- 0
Tài liệu Báo cáo khoa học: The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding pptx
... factor-induced bone formation was assessed at a single timepoint (30 days), and neither the pharmacokinetics of proBMP-2 nor the kinetics of bone formation were anal-ysed. Thus, the fate of ... and the slopes werecalculated.AcknowledgementsThis work was funded by the Land Sachsen-Anhaltthrough the program ‘Structures and Mechanisms of Biological Information Processing’ and a grantfrom ... ECD,extracellular domain;GDF-8, growthand differentiationfactor-8; HA,haemagglutinin; MBP,maltose bindingprotein; PFC,pre-formed receptorcomplex; Smad,small mothersagainst decapentaplegic;TGFb, transforminggrowth...
- 13
- 892
- 0
Từ khóa: Báo cáo quy trình mua hàng CT CP Công Nghệ NPVđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngChuong 2 nhận dạng rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ