báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L ) transcriptomes by massively parallel pyrosequencing" doc

báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L.) transcriptomes by massively parallel pyrosequencing" doc

báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L.) transcriptomes by massively parallel pyrosequencing" doc

... Kalavacharla et al.: Identification and analysis of common bean (Phaseolus vulgaris L. ) transcriptomes by massively parallel pyrosequencing. BMC Plant Biology 2011 11:135. Kalavacharla et al. BMC Plant ... 18 RESEARCH ARTICLE Open Access Identification and analysis of common bean (Phaseolus vulgaris L. ) transcriptomes by massively...

Ngày tải lên: 11/08/2014, 11:21

18 279 0
báo cáo khoa học: "Identification and analysis of phosphorylation status of proteins in dormant terminal buds of poplar" pptx

báo cáo khoa học: "Identification and analysis of phosphorylation status of proteins in dormant terminal buds of poplar" pptx

... GAPC isoforms (821843, 575307 and 72899 8) and three PEPC isoforms (552645, 745223, and 72831 5) were phosphorylated (Additional file 13 and Additional file 3). Liu et al. BMC Plant Biology 2011, ... Proteins whose ortholog(s) are phosphorylated 110 5) Equivalent site(s) are phosphorylated in ortholog(s) 62 6) Other site(s) are phosphorylated in ortholog(s) 48 Liu et...

Ngày tải lên: 11/08/2014, 11:21

16 343 0
Báo cáo khoa học: " Identification and prevalence of Ehrlichia chaffeensis infection in Haemaphysalis longicornis ticks from Korea by PCR, sequencing and phylogenetic analysis based on 16S rRNA gene" docx

Báo cáo khoa học: " Identification and prevalence of Ehrlichia chaffeensis infection in Haemaphysalis longicornis ticks from Korea by PCR, sequencing and phylogenetic analysis based on 16S rRNA gene" docx

... generally characterized by clinical signs of fever (100 %), rash (67 %), myalgia (58 %), vomiting, diarrhea, and headache (25 %) [2,12,26]. Diagnosis of HME is still largely based on the combined evaluation ... identical or similar to the Arkansas (AF41676 4), the Sapulpa (U6047 6) and the 91HE17 (U2350 3) strains, all of these originate from the USA (Table 2)....

Ngày tải lên: 07/08/2014, 18:21

5 353 0
báo cáo khoa học: " Identification and characterization of wheat long non-protein coding RNAs responsive to powdery mildew infection and heat stress by using microarray analysis and SBS sequencing" ppsx

báo cáo khoa học: " Identification and characterization of wheat long non-protein coding RNAs responsive to powdery mildew infection and heat stress by using microarray analysis and SBS sequencing" ppsx

... figure displays all the possible ORFs in the full length cDNA of TalnRNA21, and none of them are longer than 80aa. Additional file 9: The short possible ORFs in TahlnRNA37. The figure displays all the ... (Additional file 1), and all of them had similar expression pattern in microarray analysis and SBS sequencing. Most of these long npcRNAs produced more than one small RNA...

Ngày tải lên: 11/08/2014, 11:21

13 417 0
Báo cáo khoa học: "Synthesis and analysis of biomass and net primary productivity in Chinese forests" docx

Báo cáo khoa học: "Synthesis and analysis of biomass and net primary productivity in Chinese forests" docx

... personal communication). The types of field measurements of biomass and NPP that are available for biomes worldwide depend largely on plant growthform and life cycle length. NPP is gener- ally calculated ... area of a needle leaf, a and b are the width of a leaf at top and bottom, respectively, and L is the length of a needle leaf. The specific leaf area of each tree s...

Ngày tải lên: 08/08/2014, 14:21

34 218 0
Báo cáo y học: "Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates" docx

Báo cáo y học: "Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates" docx

... S4 in Additional file 1 for allele frequency information). Each of the nonsense alleles should effec tively pseudogenize the gene, as all three SNPs are located in the early part of the coding sequences. ... equilibrium for the two alleles of each SNP in each population and all populations combined. Our statistical analysis shows that, in the meta-population, the two alleles, T/G,...

Ngày tải lên: 09/08/2014, 20:21

17 450 0
báo cáo khoa học: " Characterization and analysis of the cotton cyclopropane fatty acid synthase family and their contribution to cyclopropane fatty acid synthesis" pot

báo cáo khoa học: " Characterization and analysis of the cotton cyclopropane fatty acid synthase family and their contribution to cyclopropane fatty acid synthesis" pot

... the pyrolytic alkylation of acidic compounds. Anal Lett 1982, 15:841-850. 35. Christie WW, (Ed .): Lipid Analyalysis: Isolation, Separation, Identification and Structural Analysis of Lipids. Bridgwater, ... first aligned by CLUSTALW version 2.0.12 (Additional file 1) [28] with default para- meters (http://www.ebi.ac.uk/Tools/clustalw /), and imported into the Molecular Ev...

Ngày tải lên: 11/08/2014, 11:20

10 324 0
báo cáo khoa học: " Identification and characterization of the Nonrace specific Disease Resistance 1 (NDR1) orthologous protein in coffee" doc

báo cáo khoa học: " Identification and characterization of the Nonrace specific Disease Resistance 1 (NDR1) orthologous protein in coffee" doc

... FPLRSSFPISVLMNLLVFFAIR AtNHL38 234 LPLRSSFPIFVLMNLLVFFAIR AtNHL16 197 QRLTFFQVCFSIICVLMNWLIFLAIR CaNDR1a 195 VRCPGLVVISIALYFLVLLL CaNDR1b 195 VRCPGLVVISIALYFLVLLL * Figure 2 NDR1, N HL16 and NHL3 8 are the closest Arabidopsis ... MTKIDPEEELGRKCCTCFFKFIFTTRLGALILWLS-LRAKKPKCSIQNFYIPALSKNL AtNHL16 1 -MDRDDAWEWFVTIVGSLMTLLYVSFLLALCLWLSTLVHHIPRCSIHYFYIPALNKSL CaNDR1a 1 MSDPSSSAGGCCRCCCSFILT...

Ngày tải lên: 11/08/2014, 11:21

17 455 0
báo cáo khoa học: " Identification and characterisation of seed storage protein transcripts from Lupinus angustifolius" docx

báo cáo khoa học: " Identification and characterisation of seed storage protein transcripts from Lupinus angustifolius" docx

... sequences and L. angustifolius (A) 11S globulin (a conglutin), (B) 7S globulin (b conglutin), (C) basic 7S (g conglutin) and (D) 2S sulphur-rich albumin (δ conglutin) deduced amino acid sequences. L. angustifolius ... white lupin (La 1) and peanut than to NLL ALPHA2 or ALPHA3 (Figure 3A). In general, 7S globuli n sequences showed greatest identity within species (Figure 3B). For e...

Ngày tải lên: 11/08/2014, 11:21

15 560 0
báo cáo khoa học: " Identification and characterization of flowering genes in kiwifruit: sequence conservation and role in kiwifruit flower development" ppt

báo cáo khoa học: " Identification and characterization of flowering genes in kiwifruit: sequence conservation and role in kiwifruit flower development" ppt

... 15 $3  $UDELGRSVLV &$/$UDELGRSVLV 648$$QWLUUKLQXP $3OLNH9LWLV 0W3,00HGLFDJR 3,03LVXP 0G$30DOXV )8 /$UDELGRSVLV )8 /OLNH$FWLQLGLD )8 /OLNH9LWLV ($3(XFDO\SWXV )8 /$FWLQLGLD 3)* 3HWXQLD 70/\FRSHUVLFRQ 0$'61LFRWLDQD 0$'61LFRWLDQD 6(3$FWLQLGLD )% 33HWXQLD 6(3$UDELGRSVLV 6(3$UDELGRSVLV 6(3$UDELGRSVLV 6(3$FWLQLGLD ' ()+ ...

Ngày tải lên: 11/08/2014, 11:22

16 389 0
w