0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L ) transcriptomes by massively parallel pyrosequencing" doc

báo cáo khoa học:

báo cáo khoa học: " Identification and analysis of common bean (Phaseolus vulgaris L.) transcriptomes by massively parallel pyrosequencing" doc

... Kalavacharla et al.: Identification and analysis of common bean (Phaseolus vulgaris L. ) transcriptomes by massively parallel pyrosequencing. BMC Plant Biology 2011 11:135.Kalavacharla et al. BMC Plant ... 18RESEARCH ARTICLE Open Access Identification and analysis of common bean (Phaseolus vulgaris L. ) transcriptomes by massively parallel pyrosequencingVenu Kalavacharla1,4*, Zhanji Liu1, Blake C Meyers2, ... with a broad role in plant development(especially in lignocelluloses and cell wall development) and response to external stimuli [39]. Several NACgenes were induced by cold and dehydration...
  • 18
  • 279
  • 0
báo cáo khoa học:

báo cáo khoa học: "Identification and analysis of phosphorylation status of proteins in dormant terminal buds of poplar" pptx

... GAPC isoforms (821843, 575307 and 72899 8) and three PEPC isoforms (552645, 745223, and 72831 5) werephosphorylated (Additional file 13 and Additional file 3). Liu et al. BMC Plant Biology 2011, ... Proteins whose ortholog(s) are phosphorylated 110 5) Equivalent site(s) are phosphorylated in ortholog(s) 62 6) Other site(s) are phosphorylated in ortholog(s) 48Liu et al. BMC Plant Biology 2011, 11:158http://www.biomedcentral.com/1471-2229/11/158Page ... Functionalcharacterization of the Arabidopsis eukaryotic translation initiation factor5A-2 that plays a crucial role in plant growth and development by regulating cell division, cell growth, and cell...
  • 16
  • 343
  • 0
Báo cáo khoa học:

Báo cáo khoa học: " Identification and prevalence of Ehrlichia chaffeensis infection in Haemaphysalis longicornis ticks from Korea by PCR, sequencing and phylogenetic analysis based on 16S rRNA gene" docx

... generally characterized by clinical signs of fever (100 %), rash (67 %), myalgia (58 %), vomiting,diarrhea, and headache (25 %) [2,12,26]. Diagnosis of HMEis still largely based on the combined evaluation ... identical or similar to the Arkansas(AF41676 4), the Sapulpa (U6047 6) and the 91HE17(U2350 3) strains, all of these originate from the USA (Table 2). The phylogenetic analysis also revealed that ... We also performed phylogenetic analysis of EC-PGHL strain in order to determine the epidemiologicalorigin. Phylogenetic analysis also revealed that the sequence of E. chaffeensis EC-PGHL clustered...
  • 5
  • 353
  • 0
báo cáo khoa học:

báo cáo khoa học: " Identification and characterization of wheat long non-protein coding RNAs responsive to powdery mildew infection and heat stress by using microarray analysis and SBS sequencing" ppsx

... figuredisplays all the possible ORFs in the full length cDNA of TalnRNA21, and none of them are longer than 80aa.Additional file 9: The short possible ORFs in TahlnRNA37. The figuredisplays all the ... (Additional file 1), and all of them had similar expression pattern inmicroarray analysis and SBS sequencing. Most of theselong npcRNAs produced more than one small RNAfamily. For example, TapmlnRNA11 ... TalnRNA9 was expressed quitedifferently between leaf and flag leaf, and the transcriptsaccumulated predominantly in leaf (Figure 1 1). Experimentally verified full length cDNA of predictedlong...
  • 13
  • 417
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Synthesis and analysis of biomass and net primary productivity in Chinese forests" docx

... personal communication).The types of field measurements of biomass and NPPthat are available for biomes worldwide depend largelyon plant growthform and life cycle length. NPP is gener-ally calculated ... area of a needle leaf, a and b arethe width of a leaf at top and bottom, respectively, and L is the length of a needle leaf.The specific leaf area of each tree species was thencalculated based ... BIOME3-modelled NPPReliable field-derived NPP data from terrestrial eco-systems are needed for validating and calibratingglobalbiogeochemical models. These data are also potentiallyuseful to mechanistically...
  • 34
  • 217
  • 0
Báo cáo y học:

Báo cáo y học: "Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates" docx

... S4 in Additional file 1 forallele frequency information). Each of the nonsensealleles should effec tively pseudogenize the gene, as allthree SNPs are located in the early part of the codingsequences. ... equilibriumfor the two alleles of each SNP in each population and all populations combined. Our statistical analysis showsthat, in the meta-population, the two alleles, T/G, of rs4940595 are not ... the signals of losses of well-establishedgenes. Our method is able to systematically detect thesequence signature left by such genic losses, distin-guishing true loss from m ere loss of redundant...
  • 17
  • 450
  • 0
báo cáo khoa học:

báo cáo khoa học: " Characterization and analysis of the cotton cyclopropane fatty acid synthase family and their contribution to cyclopropane fatty acid synthesis" pot

... the pyrolytic alkylation of acidiccompounds. Anal Lett 1982, 15:841-850.35. Christie WW, (Ed .): Lipid Analyalysis: Isolation, Separation, Identification and Structural Analysis of Lipids. Bridgwater, ... first aligned by CLUSTALWversion 2.0.12 (Additional file 1) [28] with default para-meters (http://www.ebi.ac.uk/Tools/clustalw /), and imported into the Molecular Evolutionary Genetics Ana-lysis ... in lea f and flower butreduced levels in root and stem (Figure 2, C). All threeGhCPS gene-transcript levels increased with seed devel -opment (Figure 2). Expression of GhCPS1 and 2 correlates...
  • 10
  • 324
  • 0
báo cáo khoa học:

báo cáo khoa học: " Identification and characterization of the Nonrace specific Disease Resistance 1 (NDR1) orthologous protein in coffee" doc

... FPLRSSFPISVLMNLLVFFAIRAtNHL38 234 LPLRSSFPIFVLMNLLVFFAIRAtNHL16 197 QRLTFFQVCFSIICVLMNWLIFLAIRCaNDR1a 195 VRCPGLVVISIALYFLVLLL CaNDR1b 195 VRCPGLVVISIALYFLVLLL *Figure 2 NDR1, N HL16 and NHL3 8 are the closest Arabidopsis ... MTKIDPEEELGRKCCTCFFKFIFTTRLGALILWLS-LRAKKPKCSIQNFYIPALSKNL AtNHL16 1 -MDRDDAWEWFVTIVGSLMTLLYVSFLLALCLWLSTLVHHIPRCSIHYFYIPALNKSL CaNDR1a 1 MSDPSSSAGGCCRCCCSFILTSGLTALFMWLS-LRGSKPSCSIEDFYVPSLNATDNS CaNDR1b 1 ... AtNHL38 31 LILWLS-LRAKKPKCSIQNFYIPALSKNL SSRDNTTLNFMVRCDNPNKDKGIYYDDVHLTFSTINTTTTNSSDLVLVANYTVPKFYQGH-K 118 AtNHL16 30 LCLWLSTLVHHIPRCSIHYFYIPALNKSL ISSDNTTLNFMVRLKNINAKQGIYYEDLHLSFSTRINNSS LLVANYTVPRFYQGH-E...
  • 17
  • 455
  • 0
báo cáo khoa học:

báo cáo khoa học: " Identification and characterisation of seed storage protein transcripts from Lupinus angustifolius" docx

... sequences and L. angustifolius (A) 11S globulin (a conglutin),(B) 7S globulin (b conglutin), (C) basic 7S (g conglutin) and (D) 2S sulphur-rich albumin (δ conglutin) deduced amino acid sequences. L. angustifolius ... whitelupin (La 1) and peanut than to NLL ALPHA2 orALPHA3 (Figure 3A). In general, 7S globuli n sequencesshowed greatest identity within species (Figure 3B). Forexample all NLL b conglutin-like ... beeen classified into four families, termed 11S glo-bulin (also known as a conglutin, legumin, legumin-like and glycinin), 7S globulin (also known as b conglutin,vicilin, convicilin and vicilin-type),...
  • 15
  • 559
  • 0
báo cáo khoa học:

báo cáo khoa học: " Identification and characterization of flowering genes in kiwifruit: sequence conservation and role in kiwifruit flower development" ppt

... 15$3$UDELGRSVLV&$/$UDELGRSVLV648$$QWLUUKLQXP$3OLNH9LWLV0W3,00HGLFDJR3,03LVXP0G$30DOXV )8 /$UDELGRSVLV )8 /OLNH$FWLQLGLD )8 /OLNH9LWLV($3(XFDO\SWXV )8 /$FWLQLGLD 3)* 3HWXQLD70/\FRSHUVLFRQ0$'61LFRWLDQD0$'61LFRWLDQD6(3$FWLQLGLD )% 33HWXQLD6(3$UDELGRSVLV6(3$UDELGRSVLV6(3$UDELGRSVLV6(3$FWLQLGLD' ()+ $QWLUUKLQXP )% 33HWXQLD6(3$FWLQLGLD6(3$UDELGRSVLV1$*1LFRWLDQDS0$'63HWXQLD7$*6RODQXP )$ 5,1(//,$QWLUUKLQXP$*$FWLQLGLD0$'6*RVV\SLXP37$*3RSXOXV37$*3RSXOXV0W$*0HGLFDJR3V0$*3LVXP*$*$*HUEHUD$*+HOLDQWKXV*$*$*HUEHUD$*$UDELGRSVLV )% 33HWXQLD3/(1$$QWLUUKLQXP9Y0$'69LWLV3V06+33LVXP$*/6+3$UDELGRSVLV$*/6+3$UDELGRSVLV%Q6+3%UDVVLFD0$'6*RVV\SLXP9Y0$'69LWLV$*/67.$UDELGRSVLV7$*6RODQXP )% 33HWXQLD )% 33HWXQLD3,$FWLQLGLD30$'63HWXQLD )% 33HWXQLD*/2$QWLUUKLQXP3V3,3LVXP3,$UDELGRSVLV$3$FWLQLGLD*' () *HUEHUD$3$UDELGRSVLV$3$FWLQLGLD' () $QWLUUKLQXP*33HWXQLD$3 )8 /3,$367.OLNH$*6(3 )0 ,%&'($Figure ... 15$3$UDELGRSVLV&$/$UDELGRSVLV648$$QWLUUKLQXP$3OLNH9LWLV0W3,00HGLFDJR3,03LVXP0G$30DOXV )8 /$UDELGRSVLV )8 /OLNH$FWLQLGLD )8 /OLNH9LWLV($3(XFDO\SWXV )8 /$FWLQLGLD 3)* 3HWXQLD70/\FRSHUVLFRQ0$'61LFRWLDQD0$'61LFRWLDQD6(3$FWLQLGLD )% 33HWXQLD6(3$UDELGRSVLV6(3$UDELGRSVLV6(3$UDELGRSVLV6(3$FWLQLGLD' ()+ $QWLUUKLQXP )% 33HWXQLD6(3$FWLQLGLD6(3$UDELGRSVLV1$*1LFRWLDQDS0$'63HWXQLD7$*6RODQXP )$ 5,1(//,$QWLUUKLQXP$*$FWLQLGLD0$'6*RVV\SLXP37$*3RSXOXV37$*3RSXOXV0W$*0HGLFDJR3V0$*3LVXP*$*$*HUEHUD$*+HOLDQWKXV*$*$*HUEHUD$*$UDELGRSVLV )% 33HWXQLD3/(1$$QWLUUKLQXP9Y0$'69LWLV3V06+33LVXP$*/6+3$UDELGRSVLV$*/6+3$UDELGRSVLV%Q6+3%UDVVLFD0$'6*RVV\SLXP9Y0$'69LWLV$*/67.$UDELGRSVLV7$*6RODQXP )% 33HWXQLD )% 33HWXQLD3,$FWLQLGLD30$'63HWXQLD )% 33HWXQLD*/2$QWLUUKLQXP3V3,3LVXP3,$UDELGRSVLV$3$FWLQLGLD*' () *HUEHUD$3$UDELGRSVLV$3$FWLQLGLD' () $QWLUUKLQXP*33HWXQLD$3 )8 /3,$367.OLNH$*6(3 )0 ,%&'($Figure ... 15$3$UDELGRSVLV&$/$UDELGRSVLV648$$QWLUUKLQXP$3OLNH9LWLV0W3,00HGLFDJR3,03LVXP0G$30DOXV )8 /$UDELGRSVLV )8 /OLNH$FWLQLGLD )8 /OLNH9LWLV($3(XFDO\SWXV )8 /$FWLQLGLD 3)* 3HWXQLD70/\FRSHUVLFRQ0$'61LFRWLDQD0$'61LFRWLDQD6(3$FWLQLGLD )% 33HWXQLD6(3$UDELGRSVLV6(3$UDELGRSVLV6(3$UDELGRSVLV6(3$FWLQLGLD' ()+ $QWLUUKLQXP )% 33HWXQLD6(3$FWLQLGLD6(3$UDELGRSVLV1$*1LFRWLDQDS0$'63HWXQLD7$*6RODQXP )$ 5,1(//,$QWLUUKLQXP$*$FWLQLGLD0$'6*RVV\SLXP37$*3RSXOXV37$*3RSXOXV0W$*0HGLFDJR3V0$*3LVXP*$*$*HUEHUD$*+HOLDQWKXV*$*$*HUEHUD$*$UDELGRSVLV )% 33HWXQLD3/(1$$QWLUUKLQXP9Y0$'69LWLV3V06+33LVXP$*/6+3$UDELGRSVLV$*/6+3$UDELGRSVLV%Q6+3%UDVVLFD0$'6*RVV\SLXP9Y0$'69LWLV$*/67.$UDELGRSVLV7$*6RODQXP )% 33HWXQLD )% 33HWXQLD3,$FWLQLGLD30$'63HWXQLD )% 33HWXQLD*/2$QWLUUKLQXP3V3,3LVXP3,$UDELGRSVLV$3$FWLQLGLD*' () *HUEHUD$3$UDELGRSVLV$3$FWLQLGLD' () $QWLUUKLQXP*33HWXQLD$3 )8 /3,$367.OLNH$*6(3 )0 ,%&'($Figure...
  • 16
  • 389
  • 0

Xem thêm

Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngchuyên đề điện xoay chiều theo dạngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Chuong 2 nhận dạng rui roGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ