báo cáo khoa học: "Journal of hematology & oncology: A journal open to all Delong Liu" pdf

báo cáo khoa học: "Journal of hematology & oncology: A journal open to all Delong Liu" pdf

báo cáo khoa học: "Journal of hematology & oncology: A journal open to all Delong Liu" pdf

... Central Page 1 of 2 (page number not for citation purposes) Journal of Hematology & Oncology Open Access Editorial Journal of hematology & oncology: A journal open to all Delong Liu Address: ... can not afford to pay for the access to these expensive journals. Meanwhile, journals become more focused and increasingly specialized. Journal of Hemato...

Ngày tải lên: 10/08/2014, 22:20

2 84 0
Báo cáo khoa học: "Delineation in thoracic oncology: a prospective study of the effect of training on contour variability and dosimetric consequences" potx

Báo cáo khoa học: "Delineation in thoracic oncology: a prospective study of the effect of training on contour variability and dosimetric consequences" potx

... decreasing the overall quality of the contours. Another possible explanation would be that residents were not allowed to adapt the CTV to the natural anatomical borders of tissue, decreasing ... Zolciak-Siwinska A, Guzel-Szczepiorkowska Z, Pietrzak L, Komosinska K, Sprawka A, Garbaczewska A: Delineation variation of lymph node stations for treatment planning lung cancer radiot...

Ngày tải lên: 09/08/2014, 09:21

24 376 0
Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

... Methyl a- d-glucopyranoside was used as a glucose analog that is not a substrate of hexokinase in a glucose assay system. The data were analyzed on the basis of the Michaelis–Menten equation; the maximum activity ... that the nigerooligo- saccharides were marginally accumulated and that they constituted a small proportion of the oligosaccharides with a wide range of DP valu...

Ngày tải lên: 14/02/2014, 22:20

10 676 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

... Pharmacology, University of Calgary, Alberta, Canada 2 School of Biomedical Sciences, University of Newcastle, Callaghan, NSW, Australia Long-range signaling Biological organs display coordinated ... Inositol trisphosphate and calcium signalling. Nature 361, 315–325. 21 Callamaras N, Marchant JS, Sun XP & Parker I (1998) Activation and co-ordination of InsP3-mediated elemen- tary...

Ngày tải lên: 16/02/2014, 09:20

8 710 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

... extracellular space, because I C can pass the plasma membrane capacita- tively. Thus, the current loop can be closed via the extracellular space and the plasma membrane. This may allow capacitative ... Ca 2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium Masayuki Yamashita Department of Physiology I, Nara Medical University, Kashihara, Japan Structural orga...

Ngày tải lên: 16/02/2014, 09:20

7 641 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKR WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR 279 1 ETA-B 280 GWEQLEQCGYPVQRLVALYLAARLSWNQVDQ V IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVV...

Ngày tải lên: 18/02/2014, 04:20

15 588 0
Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx

Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx

... 2003 Dissociation of DNA polymerase a- primase complex during meiosis in Coprinus cinereus Satoshi Namekawa, Fumika Hamada, Tomoyuki Sawado†, Satomi Ishii, Takayuki Nara‡, Takashi Ishizaki, Takashi Ohuchi, ... pol a- primase complex is generally regarded as a stable protein complex. In both yeast and mammals, the pol a- primase complex can always be isolated as an intact complex. Separ...

Ngày tải lên: 20/02/2014, 11:20

10 476 0
Báo cáo khoa học: Coordination of three and four Cu(I) to the a- and b-domain of vertebrate Zn-metallothionein-1, respectively, induces significant structural changes doc

Báo cáo khoa học: Coordination of three and four Cu(I) to the a- and b-domain of vertebrate Zn-metallothionein-1, respectively, induces significant structural changes doc

... additions of Cu(I) to each domain caused the disappearance of a large set of NOESY cross-peaks and the parallel appearance of another set of cross-peaks, until a clean 2D spectrum belonging to a single ... 2007) doi:10.1111/j.1742-4658.2007.05770.x Vertebrate metallothioneins are found to contain Zn(II) and variable amounts of Cu(I), in vivo, and are believed to be i...

Ngày tải lên: 07/03/2014, 09:20

14 485 0
Báo cáo khoa học: ` Inhibition of human ether a go-go potassium channels by 2+ Ca ⁄calmodulin binding to the cytosolic N- and C-termini potx

Báo cáo khoa học: ` Inhibition of human ether a go-go potassium channels by 2+ Ca ⁄calmodulin binding to the cytosolic N- and C-termini potx

... threshold (Fig. 2) and by assuming that a CaM binding domain has to have a length of at least around 15 residues. For quantitative estimates of the binding of CaM and CaM mutants to peptides and fusion ... characterization For the mapping of CaM binding sites at hEAG1 channels the entire cytosolic sequence of the channel was presented as an array of short peptides, attache...

Ngày tải lên: 07/03/2014, 12:20

13 500 0
Báo cáo khoa học: Transport of L-arginine and nitric oxide formation in human platelets pdf

Báo cáo khoa học: Transport of L-arginine and nitric oxide formation in human platelets pdf

... intolerance (LPI). Hum. Mol. Gen. 9, 431–438. 42. Kamada, Y., Nagaretani, H., Tamura, S., Ohama, T., Maruyama, T.,Hiraoka,H.,Yamashita,S.,Yamada ,A. ,Kiso,S.,Inui,Y., Ito, N., Kayanoki, Y., Kawata, ... and demonstrate that a deficiency of endothelial NO production generates an abnormal vasomotor tone and a prothrom- botic state. In a group of patients affected with congestive heart f...

Ngày tải lên: 08/03/2014, 02:20

8 402 0
Từ khóa:
w