báo cáo khoa học: " A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro" pptx
báo cáo khoa học: " A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro" pptx
... this article as: Sun et al.: A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro. Journal of Experimental & Clinical Cancer Research ... reported VM in human gallbladder carcinomas and its clinical significance. In this study, we further studied histomorphology and hemodynamic of VM in gallbladder carcinomas in vivo and in vitro.Methods: ... 12RESEARC H Open Access A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitroWei Sun, Yue Z Fan*, Wen Z Zhang and Chun Y GeAbstractBackground:...
- 12
- 273
- 0
Báo cáo khoa học: A strategy for the generation of specific human antibodies by directed evolution and phage display An example of a single-chain antibody fragment that neutralizes a major component of scorpion venom docx
... CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAGGAGACGGTGACCAGGGTGCCJH3.link CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAAGAGACGGTGACCATTGTCCCJH4-5.link CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAGGAGACGGTGACCAGGGTTCCJH6.link CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAGGAGACGGTGACCGTGGTCCCL. ... orientation.VK1.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGACATCCAGATGACCCAGTCTCCVK2.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGATGTTGTGATGACTCAGTCTCCVK3.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGAAATTGTGTTGACGCAGTCTCCVK4.link ... GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGAAATTGTGTTGACGCAGTCTCCVK4.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGACATCGTGATGACCCAGTCTCCVK5.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGAAACGACACTCACGCAGTCTCCVK6.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGAAATTGTGCTGACTCAGTCTCCVL1.link...
- 11
- 679
- 0
Tài liệu Báo cáo khoa học: "A High-Accurate Chinese-English NE Backward Translation System Combining Both Lexical Information and Web Statistics" pdf
... combining both linguistic and statistical information to find the correct transla-tion. Our system can be split into three steps: candidate retrieving, candidate evaluating, and candidate ... Abstract Named entity translation is indispensable in cross language information retrieval nowadays. We propose an approach of combining lexical information, web sta-tistics, and inverse ... from translat-ing common words, is an “asymmetric” transla-tion. Translations of an NE in various languages can be organized as a tree according to the rela-tions of translation language pairs,...
- 8
- 569
- 0
Báo cáo khoa học: "A Pilot Study of Opinion Summarization in Conversations" docx
... contains opinion. To obtain this,we trained a maximum entropy classifier with a bag -of- words model using a combination of data sets from several domains, includingmovie data (Pang and Lee, 2004), ... Philadelphia.Andrew Hayes and Klaus Krippendorff. 2007. Answer-ing the call for a standard reliability measure for cod-ing data. Journal of Communication Methods and Measures, 1:77–89.Minqing ... somewhat against,strongly against. Therefore for each conversation,we have an abstractive summary, an extractive sum-mary, and an overall opinion for each speaker. Thefollowing shows an example...
- 9
- 442
- 0
Báo cáo khoa học: A hydrophilic cation-binding protein of Arabidopsis thaliana, AtPCaP1, is localized to plasma membrane via N-myristoylation and interacts with calmodulin and the phosphatidylinositol phosphates PtdIns(3,4,5)P3 and PtdIns(3,5)P2 pptx
... detection of PCaP1 orthologous protein in crude membrane fractions with anti-PCaP1. Lanes 1 and 6, A. thaliana; lanes 2 and 7, Raphanus sativus; lanes 3 and 8, Brassica rapa;lanes 4 and 9, B. rapa var. ... recombinant PCaP1 as the standard protein.As shown in Fig. 2A, a highly purified preparation of PCaP1 without any tag was obtained. The protein wasanalysed by SDS-PAGE and immunoblotting with ananti-PCaP1 ... glabra; lanes 5 and 10, B. oleracea var. italica. The amount of protein applied was 4 lg for A. thaliana and 40 lgfor the other plants.N. Nagasaki et al. A novel cation-binding myristoylated...
- 16
- 424
- 0
Báo cáo khoa học: "A step towards the detection of semantic variants of terms in technical documents Thierry Hamon and Adeline " potx
... height) panneau de commande (control panel) d~gradation importante (important damage) mauvaise manipulation (bad handling) intervention de l'op6rateur (intervention of the operator) volume ... Using an automatic clustering method based on noun-modifier relationship. In Proceedings of ACL'97- Student Session, Madrid, Spain. Roberto Basili, Maria Teresa Pazienza, and Paola Velardi. ... Assadi, N. Aussenac-Gilles, and A. Courcelle. 1996. Task models for techni- cal documentation accessing. In Proceedings of EKA W'96, Nottingham. Beno~t Habert, Elie Naulleau, and Adeline...
- 7
- 522
- 0
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf
... RGRRARSAPAGGGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQIMOUSE R3E 119 QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGSRAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGSHUMAN ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLFHUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLFMOUSE R3E 237 ALRYRVTGREFWDNNGGRDYALLGPEHPAGAGAAEPQGWIHFI 279RAT R3E 237 ALRYRVTGREFWDNNGGRDYALLGPEHPGGAGAAEPQGWIHFI ... QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGSHUMAN R3E 119 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSMOUSE R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLFRAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLFHUMAN...
- 12
- 381
- 0
Báo cáo khoa học: "A Pilot Study of Implicit Attitude using Latent Textual Semantics" pdf
... classification and analysis of multivariate observations. In Proceedings of Fifth Berkeley Symposium on Mathematical Statis-tics and Probability.Christopher D. Manning, Prabhakar Raghavan, , and ... and aspect -of re-lations in opinion mining. In Proceedings of the2007 Joint Conference on Empirical Methods in Natu-ral Language Processing and Computational NaturalLanguage Learning.J. MacQueen. ... online debates. In Proceedings of the Joint Conference of the 47th Annual Meeting of the ACL and the 4th International Joint Conference onNatural Language Processing of the AFNLP.Theresa Wilson,...
- 5
- 364
- 0
Báo cáo khoa học: "A Competition-Ba sed Explanation of Syntactic Attachment Preferences and Garden Path Phenomena" pot
... originally attached does not have an alternative a- node to activate, re- analysis cannot take place and a garden path results. The allowable attachment configurations are a direct consequence of ... activate instead of its required two attachments. CAPERS again settles on an ungram- matical analysis in which the current clause has an 271 Figure 4: Example pairs of incompatible attachments ... competitive mecha- nism provide a principled and uniform account of a range of human attachment preferences and garden path phe- nolnena. 1 A Competition-Based Parser A model of the human parser must...
- 8
- 503
- 0
Báo cáo khoa học: "A colliding maxillary sinus cancer of adenosquamous carcinoma and small cell neuroendocrine carcinoma - a case report with EGFR copy number analysis" pot
... rapidly and the patient expired at 8 months after surgery.Conclusion: A colliding tumor of squamous cell, adenocarcinoma and neuroendocrine carcinoma in maxillarysinus was aggressive in behavior ... Avitia S, Osborne RF: Blindness: a sequela of sinonasal small cellneuroendocrine carcinoma. Ear Nose Throat J 2004, 83:530-532.14. Alos L, Castillo M, Nadal A, Caballero M, Mallofre C, Palacin ... Palacin A, Cardesa A: Adenosquamous Carcinoma of the head and neck: criteria for diagnosis in a study of 12 cases. Histopathology 2004, 44:570-579.15. Babin E, Rouleau V, Vedrine PO, Toussaint...
- 5
- 342
- 0
Từ khóa: Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ