Báo cáo y học: "Kbus/Idr, a mutant mouse strain with skeleta

Báo cáo khoa học: NtKTI1, a Kunitz trypsin inhibitor with antifungal activity from Nicotiana tabacum, plays an important role in tobacco’s defense response pot

... NtKTI1, a Kunitz trypsin inhibitor with antifungal activity from Nicotiana tabacum, plays an important role in tobacco’s defense response Hao Huang*, Sheng-Dong Qi*, Fang Qi, Chang-Ai Wu, ... that NtKTI1 exerted prominent antifungal activity towards R. solani and moderate antifungal activity against Rhizopus nigricans and Phytophthora parasitica v...

Ngày tải lên : 23/03/2014, 03:20

13
501
0

Báo cáo y học: "Citrullination, a possible functional link between susceptibility genes and rheumatoid arthritis" ppsx

... Sawada T, Suzuki M, Nagasaki M, Nakayama-Hamada M, Kawaida R, Ono M, Ohtsuki M, Furukawa H, Yoshino S, Yukioka M, Tohma S, Matsubara T, Wakitani S, Teshima R, Nishioka Y, Sekine A, Iida A, Takahashi ... enzyme are associated with RA. Commentary Citrullination, a possible functional link between susceptibility genes and rheumatoid arthritis Erik R Vossenaar, Albert JW Zend...

Ngày tải lên : 09/08/2014, 01:23

5
381
0

Báo cáo y học: "Adalimumab clinical efficacy is associated with rheumatoid factor and anti-cyclic citrullinated peptide antibody titer reduction: a one-year prospective study" potx

... Tin- cani A, Valesini G: Decrease of anti-cyclic citrullinated peptide antibodies and rheumatoid factor following anti-TNFα therapy (infliximab) in rheumatoid arthritis is associated with clinical improvement. ... group of patients with RA were analyzed twice with a 1-year interval. Table 2 Clinical characteristics of patients at baseline and after 24 and 48...

Ngày tải lên : 09/08/2014, 07:20

8
762
0

Báo cáo y học: "Apigenin, a non-mutagenic dietary flavonoid, suppresses lupus by inhibiting autoantigen presentation for expansion of autoreactive Th1 and Th17 cells" potx

... and stimulatory functions of APCs necessary for the activation and expansion of autoreactive Th1 and Th17 cells and B cells in lupus. Apigenin also causes apoptosis of hyperactive lupus APCs and T and ... 2 Research article Apigenin, a non-mutagenic dietary flavonoid, suppresses lupus by inhibiting autoantigen presentation for expansion...

Ngày tải lên : 09/08/2014, 14:20

13
287
0

Báo cáo y học: "Galaxy: a comprehensive approach for supporting accessible, reproducible, and transparent computational research in the life sciences" ppsx

... framework for perform- ing computational analyses, systematically repeating analyses, capturing all details of performed analyses, and annotating analyses. Using Galaxy Pages, researchers can communicate ... When a user performs an analysis using Galaxy, it automatically generates metadata for each analysis step. Galaxy’s metadata includes every piece of informa- tion necessary to...

Ngày tải lên : 09/08/2014, 20:22

13
400
0

Báo cáo y học: "T1-nerve root neuroma presenting with apical mass and Horner''''s syndrome" pps

... are necessary with this approach. However, two-staged sur- gery may be beneficial in elderly or patients with carotid artery stenosis, cardiomyopathy, coronary heart disease, history of pulmonary embolism ... lower cervical roots is rare[4]. The extra- dural component of a T1 -neuroma may present as an apical mass [5]. The diagnosis of T1 root neuromas may be particularly complex...

Ngày tải lên : 10/08/2014, 09:22

7
389
0

Báo cáo y học: "Kbus/Idr, a mutant mouse strain with skeletal abnormalities and hypophosphatemia: Identification as an allele of ‘Hyp’" pdf

... RESEARCH Open Access Kbus/Idr, a mutant mouse strain with skeletal abnormalities and hypophosphatemia: Identification as an allele of ‘Hyp’ Kenji Moriyama 1* , Atsuko Hanai 2 , Kazuyuki Mekada 3 , ... Sano M, Tokita Y, Masaki1 S, Inaguma Y, Hanai A, Sakurai N, Yoshiki A, Kusakabe M, Moriyama A, Nakayama A: Fates of Cdh23/CDH23 with mutations affecting th...

Ngày tải lên : 10/08/2014, 10:20

8
353
0

Báo cáo y học: " Paediatric Behçet’s disease presenting with recurrent papillitis and episcleritis: a case repor" ppt

... in Behỗets disease and is usually characterized by severe headache and deterioration in general condition. Infliximab, a chimeric monoclonal antibody to TNF -a, was developed and used to treat systemic ... this article as: Parentin et al.: Paediatric Behỗets disease presenting with recurrent papillitis and episcleritis: a case report. Journal of Medical Case R...

Ngày tải lên : 11/08/2014, 00:22

3
410
0

$Báo cáo y học: " Severe refractory autoimmune hemolytic anemia with both warm and cold autoantibodies that responded completely to a single cycle of rituximab: a case report" pps$

Báo cáo y học: " Severe refractory autoimmune hemolytic anemia with both warm and cold autoantibodies that responded completely to a single cycle of rituximab: a case report" pps

... Gupta et al.: Severe refractory autoimmune hemolytic anemia with both warm and cold autoantibodies that responded completely to a single cycle of rituximab: a case report. Journal of Medical Case ... case of a pa tient with mixed- type AIHA who did not respond to steroid therapy but showed a complete response to only one cycle o...

Ngày tải lên : 11/08/2014, 00:23

5
368
0

Báo cáo y học: "Delayed ethylene glycol poisoning presenting with abdominal pain and multiple cranial and peripheral neuropathies: a case report" ppt

... Baldwin and Sran, Delayed ethylene glycol poisoning presenting with abdominal pain and multiple cranial and peripheral neuropathies: a case report Journal of Medical Case Reports 2010, 4:220 Received: ... distribution, and reproduc- tion in any medium, provided the original work is properly cited. Case report Delayed ethylene glycol poisoning prese...

Ngày tải lên : 11/08/2014, 03:20

4
316
0

Báo cáo y học: "Perforated Meckel’s diverticulum presenting with combined bowel and urinary obstruction and mimicking Crohn’s disease: a case report" pps

... diverticulum presenting with combined bowel and urinary obstruction and mimicking Crohn’s disease: a case report Banny S Wong 1 , David W Larson 2 , Thomas C Smyrk 3 , Amy S Oxentenko 1* Abstract Introduction: ... rectal lumen and base of the urinary bladder, associated with terminal ileal thickening and an ileocecal fistula. A flexible sigmoidoscopy wit...

Ngày tải lên : 11/08/2014, 03:21

5
277
0

Báo cáo y học: "Perforated Meckel’s diverticulum presenting with combined bowel and urinary obstruction and mimicking Crohn’s disease: a case report" doc

... rectal lumen and base of the urinary bladder, associated with terminal ileal thickening and an ileocecal fistula. A flexible sigmoidoscopy with an endorectal ultrasound scan displayed a complex abscess ... with combined bowel and urinary obstruction and mimicking Crohn’s disease: a case report Banny S Wong 1 , David W Larson 2 , Thomas C Smyrk 3 , Amy S O...

Ngày tải lên : 11/08/2014, 07:20

5
308
0

Báo cáo y học: "PopMod: a longitudinal population model with two interacting disease states" ppsx

... models modelling only two disease states (e.g. diseased and healthy). PopMod of course includes the two- disease- state model as a special case. There is also heterogeneity other than of disease and ... of a systematic analytical approach to the modelling of disease interactions. This by itself represents a relatively important advance, as modellers have until now been con...

Ngày tải lên : 13/08/2014, 13:20

15
297
0

Báo cáo y học: "Can a single model explain both breast cancer and prostate cancer?" pps

... and prostate cancer. Endocr Relat Cancer 2003, 10:187-191. 15. Tsugaya M, Harada N, Tozawa K, Yamada Y, Hayashi Y, Tanaka S, Maruyama K, Kohri K: Aromatase mRNA Levels in Benign Pro- static Hyperplasia and ... Central Page 1 of 13 (page number not for citation purposes) Theoretical Biology and Medical Modelling Open Access Research Can a single model explain both brea...

Ngày tải lên : 13/08/2014, 16:21

13
330
0

Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...

Ngày tải lên : 14/08/2014, 16:21

11
467
0