Báo cáo y học: "Period-2: a tumor suppressor gene in breast cancer" pdf

... (http://proteomics .cancer. dk). J. E. Celis et al. Translational research in breast cancer FEBS Journal 272 (2005) 215 ê 2004 FEBS 5 REVIEW ARTICLE Towards discovery-driven translational research in breast cancer Julio ... The Danish Centre for Translational Breast Cancer Research (DCTB), to fight breast cancer. DCTB hosts scientists working in various ar...

Ngày tải lên: 30/03/2014, 15:20

... aim of this study was to investigate the responsiveness of the EQ-5D in breast cancer patients in their first year after treatment. Methods: The subscale global health of the disease-specific HRQoL ... cura- tively treated breast cancer patients [10] to address whether the EQ-5D is responsive to changes in HRQoL in a population of breast...

Ngày tải lên: 18/06/2014, 19:20

... in nor- mal human mammary epithelium and at a reduced level in breast cancer cells leading to an alteration in the cell cycle, cell growth, and cell survival. Materials and methods Human breast ... under investigation in our laboratory. Anchorage-independent growth in soft agar as a character- istic of in vitro tumorigenicity is correlated with enhanced tumor progression...

Ngày tải lên: 10/08/2014, 09:20

... JP: Invasive Inflammatory Myofibroblastic Tumor of the Lung. Journal of Thoracic Oncology 2009, 4:923-926. 8. Matsubara O, Tanliu NS, Kenney RM, Mark EJ: Inflammatory Pseudotumors Of The Lung ... this article as: Chen et al.: Inflammatory myofibroblastic tumor of the lung- a case report. Journal of Cardiothoracic Surgery 2010 5:55. Submit your next manuscript to...

Ngày tải lên: 10/08/2014, 09:22

... report a rare case of Küttner’s tumor of the sub-mandibular gland associated with regional lymph nodal adenopathy. Histological examination revealed that the architecture of both the sub-mandibular ... ported a rare c ase of Küttner’s tumor associated with fibrosclerosis and atypical lymphoid hyperplasia in both the sub-mandibular gland a...

Ngày tải lên: 11/08/2014, 00:23

... bilateral breast and accessory axillary breast fibroadenomas: a case report. Journal of Medical Case Reports 2010 4:267. Submit your next manuscript to BioMed Central and take full advantage of: ... Bilateral breast and axillary ultrasound examination supported the clinical findings suggestive of multiple fibroadenomas. She underwent excision of multiple bil...

Ngày tải lên: 11/08/2014, 03:21

... drafting the manuscript. MH was the clinician -in- charge of the daily care of the patient, provided the clinical background, assisted in the drafting and critical review of the manuscript. All the ... residual calcium may be seen [2]. One case of a recurrent cardiac CAT in a young patient has also been reported [3]. Another patient, a 60-year-old woman, ha...

Ngày tải lên: 11/08/2014, 03:21

... 4:267 http://www.jmedicalcasereports.com/content/4/1/267 Page 2 of 3 CAS E REP O R T Open Access Cyclosporine -A therapy-induced multiple bilateral breast and accessory axillary breast fibroadenomas: a case report Ahmed ... Bilateral breast and axillary ultrasound examination supported the clinical findings suggestive of multiple fibroadenomas. She underwent...

Ngày tải lên: 11/08/2014, 07:20

... show that the F103L and M106I NS1 gene mutations ar e adap- tive and control IAV replication and virulence. Materials and methods Cells and viruses Madin-Darbycaninekidney(MDCK)cells,human embryonic ... at days 1, 2, 3, 5 and 7 post infection. Organs were sonicated on ice and viral titer was assessed by plaque assay. Values are shown as averages +/- standard deviatio...

Ngày tải lên: 11/08/2014, 21:21

... report Diagnosing a popliteal venous aneurysm in a primary care setting: A case report Emmanouil K Symvoulakis* 1 , Spyridon Klinis 2 , Ioannis Peteinarakis 2 , Dimitrios Kounalakis 1,2 , Nikos Antonakis 1,2 , ... right popliteal fossa with pain during palpation. Colour Doppler ultrasonography revealed local widening and saccular dilatation in the right distal po...

Ngày tải lên: 11/08/2014, 21:22

... al. dilution). In arteriovenous circuits blood is driven by the patient’s blood pressure through a filter, via an extracorporeal circuit originating from an artery and terminating in a vein. However, in ... for blood purification, but are currently in the clinical testing phase. One such system is the molecular adsorbent regener- ating system device, which employs a polysulfo...

Ngày tải lên: 12/08/2014, 19:22

... (Dlg1- ) A) Intermediate transformation of Tax1 in CTLL-2 PBM Tax1 PBM Tax1 Dlg1 PBM Tax1 PBM Tax1 Tax1 Ǎ ǍǍ ǍC Tax1 Ǎ ǍǍ ǍC Tax1 Ǎ ǍǍ ǍC Tax1 Ǎ ǍǍ ǍC Tax1 Ǎ ǍǍ ǍC Tax1 Ǎ ǍǍ ǍC X X PBM Tax1 X PBM Tax1 X X Dlg1 PBM Tax1 X PBM Tax1 X X Tax1 Ǎ ǍǍ ǍC Tax1 Ǎ ǍǍ ǍC ... 5'- ggatgtttaggagtataagttGTGTGCTGTCCaacttatgctcctgaatatc- cTTTTT-3' for Dlg1- 3, 5&apos...

Ngày tải lên: 13/08/2014, 09:20

... and prostate cancer. Endocr Relat Cancer 2003, 10:187-191. 15. Tsugaya M, Harada N, Tozawa K, Yamada Y, Hayashi Y, Tanaka S, Maruyama K, Kohri K: Aromatase mRNA Levels in Benign Pro- static Hyperplasia and ... Central Page 1 of 13 (page number not for citation purposes) Theoretical Biology and Medical Modelling Open Access Research Can a single model explain both brea...

Ngày tải lên: 13/08/2014, 16:21

... of the other four genes in 40-60% of erythroid cells, seemingly an extraordinarily high percentage for random intrachromosome folding. The close proximity between several of these genes in the ... encoding the cytokine interferon ␥ (IFN␥) and specific sequences in the T H 2 locus, including the genes encoding interleukin 5 (IL5) and the DNA-repair protein Rad50 as...

Ngày tải lên: 14/08/2014, 15:20

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...

Ngày tải lên: 14/08/2014, 16:21