Báo cáo y học: " Patient-oriented gene set analysis for cancer mutation data" pps

... methods Permutation null without heterogeneity Permutation null with heterogeneity Passenger null without heterogeneity Passenger null with heterogeneity Gene oriented method Figure 4 Calibration analysis. ... Numerical Analysis for Statisticians. New York: Springer Verlag; 1999. doi:10.1186/gb-2010-11-11-r112 Cite this article as: Boca et al.: Patient-oriented gene set analysis...

Ngày tải lên: 09/08/2014, 22:23

... methods Permutation null without heterogeneity Permutation null with heterogeneity Passenger null without heterogeneity Passenger null with heterogeneity Gene oriented method Figure 4 Calibration analysis. ... stan- dard gene- oriented approach for analysis of the same data and gene sets. For the gene- oriented approach, we started out with gene- specific scores. For each gene...

Ngày tải lên: 09/08/2014, 22:23

... differential-avidity model for T-cell selection. Immunol Today 1994, 15:362-366. 11. Sebzda E, Wallace VA, Mayer J, Yeung RS, Mak TW, Ohashi PS: Positive and negative thymocyte selection induced by differ- ent ... become dialysis free. Pulmonary function tests including both forced vital capacity and diffusion capacity gradually improve. Several patients became free of supplemental inspired...

Ngày tải lên: 09/08/2014, 01:23

... 13(95% CI 9.7-16.3) 4(95% CI 2.8-5.3) paralyzed or extremely weak paralyzed C5-T1 (postfixed) extremely weak extremely weak paralyzed or extremely weak paralyzed Normal 38(95% CI, 36.6-39.4 10.1(95% ... [2]. Electro- physiological studies did not contribute, in any way, to identifying indications for surgery or to surgical plan- ning. Consequently, we no longer request electrophy - siologic...

Ngày tải lên: 10/08/2014, 10:20

... particle size increased by 24 nm for the non-cancerous group, the aver- age particle size increased only by 7 nm for the prostate cancer samples. T-test analysis of this set of assay data gave a p-value ... change was only ~0.5 nm for the 25 prostate cancer samples. T-test analysis rev ealed a p-v alue of 0.001 for this assay. Hen ce, the dif- ference observed from the canc...

Ngày tải lên: 11/08/2014, 00:23

... not yet been assigned to chromosomes and was therefore not used for synteny analysis. We examined the synteny blocks at three different levels: whole genome (Figure 2a), large-scale synteny blocks ... Incidentally, because polyploidy itself is a form of genomic 'disturbance,' it might induce a cellular response such as epigenetic silencing by hypermethylation, which may be especi...

Ngày tải lên: 09/08/2014, 20:20

... markedly stronger with lymphoma cDNA than with cDNA of B- lymphocytes were further analyzed by Northern blot hybridization. Some genes (a-myb, set, SMG-1, ND4) involved in HIV-associated lymphomagenesis ... of lymphomas h1 and h2 were analyzed by dot blot hybridization with [ 32 P]-labeled cDNA populations from SIV-associated monkey lymphomas and monkey B-lymphocytes. Those cDNAs whos...

Ngày tải lên: 02/11/2012, 11:08

... pneumonitis (HP) lymphocytes. HP lymphocytes morphology and diameter varied considerably. The cell morphology was consistent with activated-type lymphocyte. They presented cytoplasmic formations like ... Figure 4. Morphology of sarcoid lymphocytes. The sar- coid lymphocytes displayed mature, small shape dominant, and also regular size cells. They had round-shape nuclei and scanty cytopla...

Ngày tải lên: 03/11/2012, 11:48

... 5-bromo-4-chloro-3-indo- lyl b-galactopyranoside (X-gal; 20 mgÆmL )1 in dimethyl- formamide) per 100 mL. Incubation was performed at 30 °C for up to 12 h. For the liquid assay 5 mL cultures with synthetic medium ... stimulates CK2a catalytic activity toward synthetic peptide; (b) it inhibits phosphorylation of calmodulin and mediate s stimulation of CK2 a by polylysine; (c) it is able to...

Ngày tải lên: 21/02/2014, 15:20

... PITGMLQQHFIRVSAMKNGQFFYNLTVSVAKYPTFKSFQCVNNLTSVYLNGDLVYTSNETTDVTSAGVYFKAGGPITYKVMREVKALAYFVNGTAQDVILCDGSPRGLLACQYNTGNFSD H120 121 S L R M41 121 KN.L L K Egypt/F/3 241 GFYPFINSSLVKQKFIVYRENSVNTTFTLHYFSFHNETGANPNPSGVQNIQTYQTQTAQSGYYNFNFSFLSSFVYKESNFMYGSYHPSCNFRLETINNGLWFNSLSVSIAYGPLQGGCKQ H120 ... GFYPFINSSLVKQKFIVYRENSVNTTFTLHYFSFHNETGANPNPSGVQNIQTYQTQTAQSGYYNFNFSFLSSFVYKESNFMYGSYHPSCNFRLETI...

Ngày tải lên: 20/06/2014, 01:20