Báo cáo y học: "A fuzzy gene expression-based computational approach improves breast cancer prognostication" doc
Báo cáo y học: "A fuzzy gene expression-based computational approach improves breast cancer prognostication" doc
... Meta-analysis of gene expression profiles in breast cancer: toward a unified understanding of breast cancer subtyping and prognosis signatures. Breast Cancer Res 2008, 10:R65.10. Babuska R: Fuzzy ... positive subtypes. Here we present Gene Expression Prognostic Index Using Subtypes (GENIUS), a fuzzy approach for prognostication that takes into account the molecular heterogeneity of breast cancer. ... report here a novel, fuzzy computational approach tobuilding a risk prediction model to assess breast cancer prognosis that takes into account breast cancer heterogene-ity. We have shown that...
- 18
- 171
- 0
Báo cáo y học: "A filter-based feature selection approach for identifying potential biomarkers for lung cancer" pot
... used to analyze microarray data and to find useful genes forclassifying samples. Pathway analysis suggests that BMI is successful in identifying biomarker-quality cancer- relatedgenes from the ... microarray technology can be used to identify geneswhose expression profile in a type of cancer differs fromnormal tissues or from other types of cancer. Suchbiomarkers are important since they can ... those from the originalstudy. After pathway analysis on the selected genes by BMI, we have been able to correlate the selected geneswith well-known cancer- related pathways.Conclusions: Our results...
- 8
- 365
- 0
Báo cáo y học: "A theory of organizational readiness for change Bryan J Weiner" docx
... resource availability, and situational fac-tors. It seems unlikely that there is one best way to achievethese goals; at the same time, it seems unlikely that allways are always equally effective. ... and validity. As tworecently published reviews indicate, most of the instru-ments employed in peer-reviewed research were notdeveloped systematically using theory, nor were they sub-jected ... staff will more skillfully and persist-ently take action to put a diabetes registry in practice anddemonstrate more consistent, high-quality use of the reg-istry. By contrast, when organizational...
- 9
- 329
- 0
Báo cáo y học: "Physical Exercise and Quality of Life in Breast Cancer Survivors" potx
... of physical activity programs in comprehensive, complementary treatment regimes for breast cancer patients in Italian oncology departments. Key words: Physical exercise, quality of life, breast ... of life, breast cancer survivors, Italian Oncology INTRODUCTION Physical activity has many and varied effects on the human body. The physiological effects of physical activity and exercise ... provided preliminary evidence for the safety, feasibility, and efficacy of exercise training in breast cancer survivors. The aim of this study was to assess the association between physical exercise...
- 5
- 403
- 0
Báo cáo toán học: "Iodine Alters Gene Expression in the MCF7 Breast Cancer Cell Line: Evidence for an Anti-Estrogen Effect of Iodine" doc
... ubiquitin-conjugating enzyme E2C -2.5 NM_001071 TYMS thymidylate synthetase -2.3 NM_053056 CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) 3 -2.0 NM_002466 MYBL2 v-myb myeloblastosis viral oncogene homolog ... Nakayama K, Moriyama M, Iwanari O, Katabuchi H, Okamura H, Sakai E, Miyazaki K. Thymidine kinase in epithelial ovarian cancer: relationship with the other pyrimidine pathway enzymes. Int J Cancer ... interactions with breast cancer cells. One proposed mechanism by which iodine may influence breast physiology and cancer progression is through an interaction with estrogen pathways. Qualitative...
- 8
- 290
- 0
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"
... polymorphisms in lymphotoxin-α gene. Am J Hypertens. 2004; 17: 1045-9. 11. Sano M, Kuroi N, Nakayama T, et al. The association study of calcitonin-receptor-like receptor gene in essential hypertension. ... an-tihypertensive drugs. All EH subjects had a positive family history of hypertension; patients diagnosed with secondary hypertension were excluded from the study. We also enrolled 262 healthy, ... essential hypertension. Am J Hypertens. 1999; 12: 1144-8. 26. Takahashi Y, Nakayama T, Soma M, Izumi Y, Kanmatsuse K. Organization of the human natriuretic peptide receptor A gene. Biochem Biophys...
- 7
- 612
- 1
Báo cáo Y học: A neuropeptide Y receptor Y1-subfamily gene from an agnathan, the European river lamprey doc
... (MPPKPDNPSSDASPEELSKYMLAVRNYINLITRQRY-NH2), PYY (FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY-NH2) and NPY (FPNKPDSPGEDAPAEDLARYLSAVRHYINLITRQRY-NH2weresynthesized by solid-phase methodology on a 0.025-mmolscale ... relayed by afamily of G-protein coupled receptors [8–10]. Fivereceptors have been cloned in mammals; Y1 , Y2 , Y4 , Y5 and y6 , most of which have high affinities for NPY andPYY. Y4 is the only receptor ... evolutionarily the most distant NPY receptor that clearlybelongs to the Y1 subfamily as defined in mammals, whichshows that subtypes Y2 and Y5 arose even earlier inevolution.Keywords:NPY;PYY;evolution;geneduplication;G-protein...
- 9
- 290
- 0
Báo cáo y học: "A comparative study of the inhibitory effects of interleukin-1 receptor antagonist following administration as a recombinant protein or by gene transfer." pps
... extremely promising results[9–18]. Indeed, a phase I human study of IL-1Ra gene therapy in RA [19] was recently successfully completed.During the preclinical development of IL-1Ra gene therapy, ... may bekey to realizing the full therapeutic potential of this mater-ial. Gene delivery may offer the greatest chance of earlysuccess. Recent data from our laboratory have shown thatthe synovial ... becameprogressively less effective. This was particularly evident underconditions of continuous IL-1β synthesis.Keywords: arthritis, gene therapy, IL-1, IL-1 receptor antagonist, synoviocytesOpen...
- 9
- 421
- 0
Báo cáo y học: "A web tool for finding gene candidates associated with experimentally induced arthritis in the rat" docx
... Atelosteogenesis type II is caused by mutations inthe diastrophic dysplasia sulfate-transporter gene (DTDST):evidence for a phenotypic series involving threechondrodysplasias. Am J Hum Genet ... associated with a phenotype, but still there areusually many genes within such a region that might be possi-ble candidates. Specifically, when employing QTL analysis inrats, selecting gene candidates ... in aMySQL table labelled 'QTL'. Gene homology dataHuman gene data were assembled primarily from NationalCentre for Biotechnology Information (NCBI) [8] and the Uni-versity of California...
- 8
- 415
- 0
Báo cáo y học: " A promoter haplotype of the interleukin-18 gene is associated with juvenile idiopathic arthritis in the Japanese population" pps
... probability test; OR = 8.21, 95% CI =1.77–38.04). In the polyarthritis and systemic subgroups, thefrequency of haplotype S01 did not differ statistically from thatof healthy controls. The frequency ... liver dysfunction, splenomegaly andhyper ferritinemia [12]. Although serum levels of inflammatorycytokines are generally high in AOSD patients [13], the levelsof IL-18 were enormously high, ... aqualitative phenotype and a haplotype or haplotype setusingsimultaneous estimation of haplotype frequencies, diplo-typeconfigurations and diplotype-based penetrances. Genet-ics 2004, 168:2339-2348.34....
- 9
- 559
- 0
Từ khóa: Báo cáo quy trình mua hàng CT CP Công Nghệ NPVMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngThơ nôm tứ tuyệt trào phúng hồ xuân hươngTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ