0
  1. Trang chủ >
  2. Giáo Dục - Đào Tạo >
  3. Cao đẳng - Đại học >

Báo cáo y học: "Identification of novel genetic susceptibility loci for Behçet''''''''s disease using a genome-wide association study" pps

Báo cáo y học:

Báo cáo y học: "Presence of antibodies against cyclic citrullinated peptides in patients with ''''rhupus'''': a cross-sectional study" pdf

... theimmunoassays. RM-V participated in the analysis and interpre-tation of data and performed the statistical analysis. LG-G par-ticipated in the analysis and interpretation of data. AVparticipated ... anti-CCP antibodies = antibodies against cyclic citrullinated peptides; anti-dsDNA antibodies = antibodies against double-stranded DNA; ELISA = enzyme-linked immunosorbent assay; RA = rheumatoid ... peptides containing thenon-standard amino acid citrulline (deiminated arginine) [11]. In addition, an abnormally increased function of the enzymepeptidylarginine deiminase 4 (PAD4; responsible...
  • 5
  • 541
  • 0
Báo cáo y học:

Báo cáo y học: "Identification of novel citrullinated autoantigens of synovium in rheumatoid arthritis using a proteomic approach" pdf

... Sawada T, Suzuki M,Nagasaki M, Nakayama-Hamada M, Kawaida R, Ono M, et al.:Functional haplotypes of PADI4, encoding citrullinatingenzyme peptidylarginine deiminase 4, are associated with rheumatoid ... K,Ochiai A, Hirohata S, Shimizu M, Watanabe Y: High diagnosticvalue of anticalpastatin autoantibodies in rheumatoid arthritis detected by ELISA using human erythrocyte calpastatin asantigen. ... Sugao 2-16-1, Miyamae, Kawasaki, Kanagawa 216-8512, Japan2Musculoskeletal Science, Yokohama City University Graduate School of Medicine, Fukuura3-9, Kanazawa, Yokohama, Kanagawa 236-0004, Japan3Department...
  • 13
  • 409
  • 0
Báo cáo y học:

Báo cáo y học: " Identification of novel monosodium urate crystal regulated mRNAs by transcript profiling of dissected murine air pouch membranes" ppsx

... 1 of 13(page number not for citation purposes)Vol 10 No 3Research article Identification of novel monosodium urate crystal regulated mRNAs by transcript profiling of dissected murine air pouch ... baselineexpression of IL-6 or PUMA-g mRNAs in myocytes and adi-pocytes might possibly have precluded a microarray-based identification of these mRNAs as being highly inducible by MSU crystals. Open ... concentration.DiscussionUsing microarray analysis of meticulously dissected air pouch membranes, we identified several genes relating to innateimmunity that were induced strongly by MSU crystals. Four of the six factors...
  • 13
  • 368
  • 0
Báo cáo y học:

Báo cáo y học: "Identification of novel genetic susceptibility loci for Behçet''''s disease using a genome-wide association study" pps

... the acquisition of data. RW performed theacquisition and analysis of data. BLC performed the analysis of pooling data. HD and GS-D provided DNA samples, made a substantial contribution to the acquisition ... technology and the Affymetrix500K arrays, we identified possible candidate geneassociations with Behỗet's disease in a cohort of 152 Behỗet's disease patients and 172 healthy ethnically matched ... Kanawati C, Ghabra M, Murray PI, Wal- Arthritis Research & Therapy Vol 11 No 3 Fei et al.Page 4 of 7(page number not for citation purposes)ease-associated gene 1' (BDAG1) as a synonym...
  • 7
  • 381
  • 0
Báo cáo y học:

Báo cáo y học: "Identification of novel exons and transcribed regions by chimpanzee transcriptome sequencing" pptx

... liverFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY Y YY Y YYYYYYYYYYYYYYYY Y YYYYYYYYY Wetterbom et al. Genome Biology 2010, 11:R78http://genomebiology.com/2010/11/7/R78Page ... discovery of novel transcripts.Direct detection of both known and novel transcripts and exons can be achieved by complete sequencing of thecDNA population. This strategy was used by Sakate ... Cavelier*AbstractBackground: We profile the chimpanzee transcriptome by using deep sequencing of cDNA from brain and liver, aiming to quantify expression of known genes and to identify novel transcribed regions. Results:...
  • 16
  • 325
  • 0
Báo cáo y học:

Báo cáo y học: "Identification of novel DNA methylation inhibitors via a two-component reporter gene system" pptx

... methyla-tion is considered as a therapeutically relevant strategy forcancer treatment. Among many agents with DNA methy-lation-modifying capability, 5-aza-2’-deoxycytidine (decita-bine; 5-Aza) ... as demonstrated by the US Food and Drug Administration approval of the DNA methyltransferase inhibitors azacytidine and 5-aza-2’-deoxycytidine for the treatment of myelodysplastic syndromes. But ... Our data provide a proof -of- concept that procainamide could be pharmacologically exploited todevelop novel DNA methylation inhibitors, of which the translational potential in cancer therapy/prevention...
  • 8
  • 426
  • 0
Báo cáo y học:

Báo cáo y học: " Identification of novel conserved functional motifs across most Influenza A viral strains" pps

... Access Identification of novel conserved functional motifs across most Influenza A viral strainsMahmoud ElHefnawi1,2*†,OsamaAlAidi3*, Nafisa Mohamed2,MonaKamar2,ImanEl-Azab4, Suher Zada2,5,RaniaSiam2,5AbstractBackground: ... of Influenza A viral genome from diverse hosts andsubtypes. We performed a systematic in silico analysis of Influenza A viral segments of all available Influenza A viral strains and subtypes and ... regions of influenza a virus polymerase gene segments are critical for efficient viral RNA packaging. J Virol 2008, 82:2295-2304.25. Obayashi E, Yoshida H, Kawai F, Shibayama N, Kawaguchi A, Nagata...
  • 10
  • 384
  • 0
Báo cáo y học:

Báo cáo y học: " Prospect of vasoactive intestinal peptide therapy for COPD/PAH and asthma: a review" ppsx

... potential of VIP for the clinicaltreatment of COPD/asthma on the basis that VIP acts as a neurotransmit ter, the dominant mechanism of humanairway and vascular relaxation, and its anti-inflammatoryproperties. ... Hamasaki Y, Saga T, Mojarad M, Said SI: Vasoactive intestinal peptide counteracts leukotriene D4-induced contractions of guinea pig trachea,lung, and pulmonary artery. Trans Assoc Am Physicians ... in ratairways in vivo. Regul Pept 2004, 117:149-54.95. Onoue S, Ohmori Y, Endo K, Yamada S, Kimura R, Yajima T: Vasoactive intestinal peptide and pituitary adenylate cyclase-activating polypeptideattenuate...
  • 8
  • 659
  • 0
Báo cáo y học:

Báo cáo y học: "Polymorphisms of two histamine-metabolizing enzymes genes and childhood allergic asthma: a case control study" doc

... RESEARC H Open AccessPolymorphisms of two histamine-metabolizing enzymes genes and childhood allergic asthma: a case control studyAleksandra Szczepankiewicz1*, Anna Bręborowicz2, Paulina ... two histamine-metabolizing enzymes genes and childhood allergic asthma: a case control study. Clinical and Molecular Allergy 2010 8:14.Submit your next manuscript to BioMed Central and take full advantage of: ... HistamineN-methyltransferase pharmacogenetics: association of a commonfunctional polymorphism with asthma. Pharmacogenetics 2000,10:261-266.17. Sasaki Y, Ihara K, Ahmed S, Yamawaki K, Kusuhara K, Nakayama...
  • 6
  • 241
  • 0
Báo cáo y học:

Báo cáo y học: " Analysis of novel geometry-independent method for dialysis access pressure-flow monitoring" pdf

... x-axis, thereby plotting the pressuredrop along the length of the access longitudinally for afamily of access flows Q. The Reynolds numbers >2300 for blood exiting the dialysis needles suggest ... 2005,16(Suppl):S120-S127.7. Roy-Chaudhury P, Kelly BS, Zhang J, Narayana A, et al.: Hemodialy-sis vascular access dysfunction: From pathophysiology to novel therapies. Blood Purif 2003, 21:99-100.8. National Kidney Foundation: ... hemodialysis arteriovenousgraft stenosis. Kidney Int 2004, 66:390-398.13. Kennedy MT, Quinton H, Bubolz TA, Wennberg JE, Wilson SE: An analysis of the patency of vascular access grafts for...
  • 12
  • 331
  • 0
Báo cáo y học:

Báo cáo y học: ":Identification of novel stem cell markers using gap analysis of gene expression data" ppsx

... PHP.AbbreviationsCYP, cytochrome P450 protein; Ebf, early B -cell factor; ESC,embryonic stem cell; GO, Gene Ontology; HSC, hematopoi-etic stem cell; mESC, murine embryonic stem cell; Nf2f,nuclear ... study we illustrate our methodology in the analysis of a database of stem- cell related DNA microarray samples thatwe previously developed (StemBase [7]). In particular, westudy 83 mouse stem cell ... method produces a set of 4,449 cell and tissue markers, including 45 out of 71 known stem cell markers (69%). Analysis of the markers that segre-gate six types of stem cells (hematopoietic, mast,...
  • 19
  • 340
  • 0
Báo cáo y học:

Báo cáo y học: "Identification of ciliated sensory neuron-expressed genes in Caenorhabditis elegans using targeted pull-down of poly(A) tails" ppsx

... sensory neurons of Caenorhabditis elegans using the mRNA-tagging method, in which poly(A) RNA was co-immunoprecipitated with an epitope-tagged poly(A)- binding proteinspecifically expressed in sensory ... epitope-taggedPABP using cell-specific promoters. Since PABP binds the poly(A) tails of mRNA [20], in situ crosslinking of RNA andproteins, followed by affinity purification of the tagged PABPfrom lysates of ... neuron-expressed genes, we adopted themRNA-tagging method [19]. In this method, poly(A)- bindingprotein (PABP), which binds the poly(A) tails of mRNA, is uti-lized to specifically pull-down poly(A) RNA...
  • 13
  • 301
  • 0
Báo cáo y học:

Báo cáo y học: "Identification of novel Y chromosome encoded transcripts by testis transcriptome analysis of mice with deletions of the Y chromosome long arm" potx

... ***********ECTSFFPIVSHTYHYVIQLYNCNHFDQHSQEYKFYV 106ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106 ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFYV 106ECTSFFPIVSKTYHYVIQLYNCNHFDQYSHEYKFMCKLLPVLCYFPPDDSF1 ... SrySxra7 copies RbmySryZfy2UtyEif2s 3y SmcyUbe 1y Zfy1Usp 9y DbyXSxr Y *xaXYDel 2/3 MSYqDel Sry Del 9/10 MSYqqdelXYRIIIXYXYRIIILarge X deletionSsty‡50 copies RbmyCENSryZfy2UtyEif2s 3y SmcyUbe 1y Zfy1TELDbyUsp 9y PAR ... R102ResearchIdentification of novel Y chromosome encoded transcripts by testis transcriptome analysis of mice with deletions of the Y chromosome long armAminata TourộÔ*, Emily J ClementeÔ, Peter...
  • 15
  • 252
  • 0
Báo cáo y học:

Báo cáo y học: " Identification of novel regulatory modules in dicotyledonous plants using expression data and comparative genomics" potx

... interactions informationOpen Access2006Vandepoeleet al.Volume 7, Issue 11, Article R103Research Identification of novel regulatory modules in dicotyledonous plants using expression data and ... identified using two-way clusteringOverview of the TFBS identified using two-way clusteringClick here for fileAdditional data file 7Overview of the 139 cis -regulatory modulesOverview of the 139 cis -regulatory ... straightforward in plants. Simi-larly, studying cooperative TFBSs within regulatory modules also suffers from the inclusion of potentially false-positiveswhen selecting genes in one species containing...
  • 15
  • 370
  • 0
Báo cáo y học:

Báo cáo y học: " Identification of novel transcripts with differential dorso-ventral expression in Xenopus gastrula using serial analysis of gene expression" pptx

... a list of at least 86 novel transcripts with differential expression in the dorso-ventral axis. Interest-ingly, the expression of three transcripts was independent of -catenin signaling. To ... differential expression alongthe dorso-ventral axis. Interestingly, the expression of some novel transcripts was independent of -catenin.Conclusions: Our SAGE analysis provides a list of novel transcripts ... knowl-edge of the transcriptome [32]. In addition, it seems thatSAGE analysis is particularly efficient for the identification of novel transcripts. Microarray analysis of genes involved in neural induction...
  • 16
  • 332
  • 0

Xem thêm

Từ khóa: báo cáo y họcbáo cáo y học cổ truyềnmẫu báo cáo y học cổ truyềnbao cao y hoc colchicinphan ban luan trong bao cao y hoc co truyenbáo cáo khoa học y họcbáo cáo y tế học đườngmẫu báo cáo y tế học đườngbáo cáo y tế học đường cuối nămbáo cáo y tế học đường năm 2012báo cáo y tế học đường trường mầm nonbiểu mẫu báo cáo y tế trường họcbáo cáo y tế học đường trường tiểu họcbáo cáo y tế trường tiểu họcbáo cáo y tế trường học năm 2012Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thơ nôm tứ tuyệt trào phúng hồ xuân hươngKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI