báo cáo khoa học: "Thick calcification from a GIST of the stomach penetrating into pericolic soft tissue - report of a case" pptx

... where appropriate, were recorded. Statisti-cal analysis was performed using SPSS 12.0 software(Chicago, IL, USA). Overall actuarial survival was calcu-lated from the day of surgery until death ... [1].In the last decade studies have discovered that nearly allGISTs are characterised by the expression of the c-kitreceptor (CD117), as is their cell of origin, the intersti-tial cell of Cajal ... paradisefor acronyms (GUMP, GIST, GANT, and now GIPACT). Implications of c-kitin genesis, and yet another of many emerging roles of the interstitialcell of Cajal in the pathogenesis of gastrointestinal...

Báo cáo khoa học: SOX10, in combination with Sp1, regulates the endothelin receptor type B gene in human melanocyte lineage cells pptx

... mCA1 (5¢-CATTCCCTCCCTGGCtCgagCCTTCCAGAACGCCCC-3¢), mGC1 (5¢-CCCCTTCCAGAACGCCCCGaaCCACTGCATATTATTTAC-3¢), mCA2 (5¢-GAACGCCCCGCCCCcCgGgATATTATTTACCCC-3¢), mGC1 ⁄mCA2 (5¢-CCCCTTCCAGAACGCCCCGaaCCcCgGgATATTATTTACCCC-3¢), ... region. In the case of the EDNRBpromoter region, the primers used were 5¢-CATTCCCTCCCTGGCACACCCCTTCCAGAACGCCCC-3¢ as a for-ward primer and 5¢-CGAGCCAAGTCGCTGCAAACGCTAATACCG-3¢ as a reverse ... GAPDH gene was ampli-ﬁed as a negative control. The primers used were 5¢-TGGTATGACAACGAATTTG-3¢ as a forward primer and 5 - TCTACATGGCAACTGTGAGG-3¢ as a reverse primer. The PCR condition was...

Báo cáo khoa học: "Letter to Editor: Carpal tunnel syndrome due to an atypical deep soft tissue leiomyoma: The risk of misdiagnosis and mismanagement" ppsx

... of Schwan-noma: the picture shows an increased cross sectional area of median nerve at palmFigure 1Schwannoma of median nerve at palm: A case of Schwannoma: the picture shows an increased cross ... Sullivan P, Lomas F: Sonography in the diagnosis of car-pal tunnel syndrome. AJR Am J Roentgenol 1999, 173:68 1-6 84.6. Padua L, Aprile I, Pazzaglia C, Frasca G, Caliandro P, Tonali P, Marti-noli ... think that, being US an inexpensive and easilyavailable method which also provides a dynamic exami-nation, it may be the first-line approach to the nerve. The cost-benefit ratio is in favour of...

Báo cáo khoa học: Hematopoietic differentiation from human ESCs as a model for developmental studies and future clinical translations Invited review following the FEBS Anniversary Prize received on 5 July 2009 at the 34th FEBS Congress in Prague docx

... individual suffering from AIDS and acute myeloid leukemia. Following trans-plantation and discontinuation of anti-retroviral ther-apy, no HIV-1 virus was detected in the patient over a 20-month ... Anemia Research FundUSA, and funds for research in the ﬁeld of regenera-tive medicine through the collaboration agreementbetween the Conselleria de Sanidad (Generalitat Valen-ciana) and the Instituto ... hematopoietic com-partment using a CD34+hESC-derived starting popu-lation has been considered as a potential AIDStherapy, and as a way to alleviate secondary effectsproduced by anti-retroviral...

Báo cáo khoa học: Antimicrobial peptides from hylid and ranin frogs originated from a 150-million-year-old ancestral precursor with a conserved signal peptide but a hypermutable antimicrobial domain pot

... for caerin 1.14, and 5¢-GAAGTACGTGCTTAGCAACGG-3¢ for caerin 1.15, and fornested PCR: 5¢-ATAACTGGAACAACGTGTGG-3¢for caerin 1.1, 5¢-CTAAGTGCTCAGCAATGACG-3¢for caerin 1.11, 5¢-AGCATAACTGGAACGTGGG-3¢ ... SVLSTITDMAKAAGRAALNAITGLVNQGEQAgalychnis annae DRP-AA11 SLGSFMKGVGKGLATVGKIVADQFGKLLEAGQGDRP-AA 2-5 GLVSGLLNTAGGLLGDLLGSLGSLSGGESDRP-AA 3-1 SLWSKIKEMAATAGKAALNAVTGMVNQGEQDRP-AA 3-3 GMFTNMLKGIGKLAGQAALGAVKTLAGEQDRP-AA 3-4 ... 5¢-GGATGCTCAACTCTTTATTGACC-3¢ for caerin 1.1, 5¢-ATGACTTTATCCTAAGGC-3¢ for caerin 1.11, 5¢-CTGAGTGAACAGCTATAACTG-3¢ for caerin 1.12, 5¢-GACTTTATCCTAAGTGTTCAGC-3¢ for caerin 1.13, 5¢-TGTGGAAGGTGTTTACTAATGG-3¢...

Báo cáo khoa học: "Extracting loanwords from Mongolian corpora and producing a Japanese-Mongolian bilingual dictionary" ppt

... Fourth, as performed by Fujii et al. (2004), we use a Japanese Katakana dictionary and extract a candidate loanword that is phonetically similar to a Katakana word as a loanword. We romanize the ... It is feasible that a large number of loanwords in Korean can also be loanwords in Japanese. Additionally, Katakana words can be extracted from Japanese corpora with a high accuracy. Thus, ... loanwords from Mongolian corpora and producing a Japanese-Mongolian bilingual dictionary Badam-Osor Khaltar Graduate School of Library, Information and Media Studies University of Tsukuba...

Báo cáo khoa học: "Extracting Paraphrases from a Parallel Corpus" pdf

... paraphrases. In addition to learning lex-ical paraphrases, the method also learns syntacticparaphrases, by generalizing syntactic patterns of the extracted paraphrases. Extracted paraphrasesare then ... syn-tactic and pragmatic constraints. Traditionally, al-ternative verbalizations are derived from a man-ual corpus analysis, and are, therefore, applica-tion speciﬁc. The second approach ... paraphrase features include lexical and syn-tactic descriptions of the paraphrase pair. The lexical feature set consists of the sequence of to-kens for each phrase in the paraphrase pair; the syntactic...

Báo cáo khoa học: Activated transglutaminase from Streptomyces mobaraensis is processed by a tripeptidyl aminopeptidase in the ﬁnal step pptx

... 0.05Ala-Ala-Pro-pNA 4304 100Ala-Phe-Pro-pNA 3258 76Ala-Ala-Ala-pNA 2080 48Pro-Leu-Gly-pNA 199 4.6Ala-Ala-Phe-pNA 86 2.0Suc-Ala-Ala-Phe-pNA < 1 < 0.05Val-Leu-Lys-pNA 5 0.1Cbz-Pro-Phe-Arg-pNA ... Ala-Ala-Val-Ala-pNA or Ala-Pro-pNA, exhibiting precisely the sequence of FRAP-TGase.Yellowing of the Ala-Ala-Val-Ala-pNA solution must be the result of direct cleavage of the anilide bond. Ala-pNAand ... The inability of the peptidase to hydrolyse Ala-Ala-pNA andAla-pNA (or other chromogenic amino acids) at reason-able rates clearly indicates exclusive cleavage of the anilidebond of Ala-Ala-Val-Ala-pNA....

báo cáo khoa học: "Surgical perspectives from a prospective, nonrandomized, multicenter study of breast conserving surgery and adjuvant electronic brachytherapy for the treatment of breast cancer" pps

... of the applicator and the resultant sur-gical cavity. The 4-5 cm spherical balloon applicator wasimplanted in 84% of patients, the 3-4 cm spherical bal-loon in 2%, the 5-6 cm s pherical balloon ... days.Assessment of the balloon and measurement of the dis-tance from balloon sur face to skin surface was evaluatedat the time of implantation as well as prior to the firsttreatment. The distance was found ... early-stagebreast cancer patients. J Clin Oncol 2005, 23:707 4-7 080.8. Athas WF, Adams-Cameron M, Hunt WC, Amir-Fazli A, Key CR: Traveldistance to radiation therapy and receipt of radiotherapy...

báo cáo khoa học: "Thick primary melanoma has a heterogeneous tumor biology: an institutional series" pot

... indata analysis and interpretation, manuscript drafting and final approval CYparticipated in data acquisition and analysis, manuscript drafting and finalapproval; BL participated in data acquisition ... tolooking at SLNB status and ulceration as individual vari-ables, we incorporated those factors into the patients’AJCC stage as a way to provide more accurate, clinicallyrelevant survival information ... acquisition and analysis, manuscriptdrafting and final approval; GW participated in study design, data analysisand interpretation, manuscript drafting and final approval; JMK participatedin study...

Xem thêm