... stability of mRNAs expressed using the tet-off system which allows the termination of only the synthesis of the mRNA under study. This enabled us to also investigate transcripts with comparatively long ... the group of samples. The next day transcription from the tetracycline- regulatable promoter was stopped by addition of doxycycline (3 lgÆmL )1 ). At the indicated times ther...
Ngày tải lên: 31/03/2014, 08:20
... prognostic accuracy. Both risk scores were validated for the predic- tion of mortality only. Their ability to predict other important adverse disease outcomes including the need for ICU admission ... relevance for public health, both for primary and hospital care. The ultimate clinical utility of a biomarker is defined by the degree it improves clinical decision making and add...
Ngày tải lên: 25/10/2012, 10:02
Báo cáo y học: " Rationale for one stage exchange of infected hip replacement using uncemented implants and antibiotic impregnated bone graft"
... concentrations provided by systemic anti- biotic therapy and commonly available carrier sys- tems are insufficient in eliminating biofilm bacteria new ways of antibiotic delivery are required. The cri- teria ... levels around 32x the MIC of planktonic forms the station- ary phase pathogens are reduced by 2 logs within 24h 42 . Vancomycin shows the least cytotoxic effect of all c...
Ngày tải lên: 26/10/2012, 09:53
Báo cáo y học: "Foundation for the Community Control of Hereditary Diseases, Budapest, Hungary"
... camptodactyly, partial syndactyly between toes 2 and 3, hydrocele, umbilical hernia, sacral dimple, etc) without serious medical or cosmetic consequences are excluded from the category of congenital ... prevalence in the past. However, recently the different methods of prenatal diagnoses have been used widely for the detection of fetal defects and pregnancies are frequently t...
Ngày tải lên: 02/11/2012, 11:12
Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot
... licheniformis 78–95 TSQA DVGYGAYDLYDLGE P06278 Bacterium Paenibacillus polymyxa 812–830 KSE YAYHGYHTYDFYAVDG P21543 Bacterium Escherichia coli 255–285 IHGWVGGGTKGDFPHYAYHGYYTQDWTNLDA P25718 G4-forming ... Other binding residues (W9 AMY2 , H92 AMY2 , T94 AMY2 , A95 AMY2 , Y1 30 AMY2 , A145 AMY2 , F180 AMY2 , K182 AMY2 , W206 AMY2 , S208 AMY2 , Y2 11 AMY2 , H288 AMY2 , Q294 AMY2 , M296 AMY2 a...
Ngày tải lên: 31/03/2014, 08:20
Báo cáo y học: "Fishing for Allergens: Bloodworm-Induced Asthma" doc
... breath and skin rash when feeding the fish. The patient keeps no pets at home, and although there is no personal history of atopy, her father has hay fever. The physical exam- ination was unremarkable ... workplace, a research laboratory that studies fish biology. On a recent holiday, her symptoms completely resolved, but they recurred within a week of her returning to work. The pat...
Ngày tải lên: 08/08/2014, 20:23
Báo cáo y học: "Validation and test-retest reliability of the Royal Free Interview for Spiritual and Religious Beliefs when adapted to a Greek population" doc
... from the community on the basis of their availability. They received a brief explanation of the purpose and the aim of the study, and those who agreed to participate were asked to sign an informed ... experience. For these four persons, the mean effect of this experience on their lives was moderate (4.69 ± 2.9). The majority of persons participating in our study answered that...
Ngày tải lên: 08/08/2014, 21:20
Báo cáo y học: "Postictal psychosis: presymptomatic risk factors and the need for further investigation of genetics and pharmacotherapy" doc
... temporal hyperperfusion as assessed by SPECT in postictal psycho- sis [19], and they thereby argue against the Todd's paraly- sis hypothesis which might predict hypoperfusion. The temporal ... I. Symmetry and convergence of the corticocortical connections of the left and the right principal sulcus (PS) and the left and the right supplementary motor area (SMA) in the r...
Ngày tải lên: 08/08/2014, 21:20
Báo cáo y học: "Fluvoxamine for aripiprazole-associated akathisia in patients with schizophrenia: a potential role of sigma-1 receptors" ppt
... with atypical antipsychotic drugs. Although understanding of the pathophysiology of akathisia remains limited, it seems that a complex interplay of several neurotransmitter systems might play a ... activity as a molecular chaperone, activity that can be activated/inactivated by synthetic compounds that bind to sigma-1 receptors [9,10]. Furthermore, sigma-1 receptors play important roles in...
Ngày tải lên: 08/08/2014, 23:21
Báo cáo y học: "Fluvoxamine for blonanserin-associated akathisia in patients with schizophrenia: report of five cases." pps
... be performed to clarify the role of sigma-1 receptors in the efficacy of fluvoxamine for akathisia. Furuse and Hashimoto Annals of General Psychiatry 2010, 9:17 http://www.annals-general-psychiatry.com/content/9/1/17 Open ... mg) for the last 4 years, but he had a ten- dency to stop the medication due to appetite and body weight. He was admitted to the hospital due to delusions...
Ngày tải lên: 08/08/2014, 23:21