Báo cáo khoa học: "An assessment of edge effect on growth and timber external quality of ayous (Triplochiton scleroxylon K Schum) under Cameroon rain forest conditions" docx
... of edge effect on growth and timber external quality of ayous (Triplochiton scleroxylon K Schum) under Cameroon rain forest conditions TB Mayaka JN Fonweban Z Tchanou P Lontchui 1 ... An investigation was conducted in order to assess the edge effect on growth characteristics and timber external quality of ayous (Tripl...
Ngày tải lên: 08/08/2014, 19:21
... cAMP-response element-binding protein-binding motif on the SOD2 promoter. SOD2 overexpression abolished the inhibi- tory effect of BetA on HBV replication, whereas SOD2 knockdown mim- icked this effect, ... combination of BetA and SOD2 overexpression totally abolished the BetA- mediated HBV-inhibitory effect. On the other hand, SOD2 knockdown (siSOD2) mimicked the BetA- induce...
Ngày tải lên: 16/03/2014, 01:20
... result of a lack of distinction among terms and the lack of a one-to-one mapping between terms and concepts, especially at the highest levels of the hierarchy. 3.1. Incomplete information The ... systematically, and those that have done so have been restricted to consideration of the quality of grammatical information (e.g., Akkerman, Masereeuw, and Meijs, 1985)....
Ngày tải lên: 24/03/2014, 05:21
Tài liệu Báo cáo khoa học: An allosteric DNAzyme with dual RNA-cleaving and DNA-cleaving activities doc
... substrate and RNase A, we constructed a simple conformational switch to control the DNA- cleaving activity of DRc DNAzyme. The generation of a new active site within a DNAzyme scaffold and reg- ulation ... being reached at 100 lm. The rate of DNA cleavage was highly dependent on the concentration of Cu 2+ used in the reaction mixture. When the concentration of Cu 2+ was higher...
Ngày tải lên: 16/02/2014, 15:20
Tài liệu Báo cáo khoa học: "An Open Source Toolkit for Phrase-based and Syntax-based Machine Translation" docx
... Decoder, Alignment, and Learning Framework for Finite-State and Context-Free Translation Models. In Proc. of ACL 2010 System Demonstrations, pages 7- 12. Jason Eisner. 2003. Learning non-isomorphic ... Galley, Jonathan Graehl, Kevin Knight, Daniel Marcu, Steve DeNeefe, Wei Wang and Ignacio Thayer. 2006. Scalable inferences and training of context-rich syntax translation mod...
Ngày tải lên: 19/02/2014, 20:20
Tài liệu Báo cáo khoa học: "An Unsupervised Model for Joint Phrase Alignment and Extraction" ppt
... 49. 8k 49. 8k 49. 8k 68. 9k Tune (other) 47. 2k 52. 6k 55. 4k 80. 4k Test (en) 65. 6k 65. 6k 65. 6k 40. 4k Test (other) 62. 7k 68. 1k 72. 6k 48. 7k Table 1: The number of words in each corpus for TM and LM training, ... Utiyama, Mikio Yamamoto, and Takehito Utsuro. 2008. Overview of the patent trans- lation task at the NTCIR-7 workshop. In Proceedings of the 7th NTCI...
Ngày tải lên: 20/02/2014, 04:20
Báo cáo khoa học: "An Architecture for Dialogue Management, Context Tracking, and Pragmatic Adaptation in Spoken Dialogue Systems" pot
... referents) Back-end command Pragmatic Adaptation on Output Context Tracking on Output Dialogue Manager Convert back-end response to logical form representation of communicative act Track discourse ... contribution of this work is thus in the generic definition of standard dialogue func- tions such as dynamic troubleshooting (repair), context updating, anaphora resolution,...
Ngày tải lên: 17/03/2014, 07:20
Báo cáo khoa học nông nghiệp " CLOSER LINKS BETWEEN RESEARCH, PRODUCTION AND MARKET TO ASSURANCE OF SAFETY AND HIGH QUALITY VEGETABLES FOR CONSUMERS " potx
... 100 kg/ha P 2 O 5 and 50kg/ha of K 2 O. IPM resulted in adequate control of insects. GAP production pilots: At the same time of trials at ASINCV, production demonstrations were carried out on ... 4. Kawakami, T., T. T. Khai, et al. (1999). "Development and practice of the participatory programme on improving working and living conditions in rural communities...
Ngày tải lên: 21/06/2014, 05:20
Báo cáo khoa học: "The Corpora Management System Based on Java and Oracle Technologies" potx
... annota- tion and corpora manipulation procedures. Reusability of linguistic and corpora manipulation business services could be achieved by usage of a widely accepted set of UML notation standards ... HTML, and Oracle9i components (Yablonsky S.A., 2002). The system was by adapt- ing existing and new DBMS and Java tools to the necessities of the intended task for the Russian...
Ngày tải lên: 31/03/2014, 20:20
Tài liệu Báo cáo khoa học: An alternative isomerohydrolase in the retinal Muller cells of a cone-dominant species doc
... | | | ETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYV L .K M NI V R M GA.L R T .K S E KV SAE V .K L L A M.L EE.S LAM.KVL S.E V .K L L A M.L E S.QFE K. L S.E ... 11cRAL to cone photoreceptors in cone-dominant species. Identification of an alterna- tive visual cycle will contribute to the understanding of the functional differ- ences of rod an...
Ngày tải lên: 14/02/2014, 14:20