Báo cáo khoa học: " A novel b-glucan produced by Paenibacillus polymyxa JB115 induces nitric oxide production in RAW264.7 macrophages" docx

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport...

Ngày tải lên: 18/02/2014, 08:20

... of wild-type occludin (Occ WT ) and variant occludin in apoptosis and invasion, as determined by assay, we revealed that exon 9 played a major role in the induc- tion of mitochondria-mediated apoptosis and ... (sense) and 5Â-GAAAAAACGCGATCCTACTT-3Â (antisense). Primers for unmethylated DNA were: 5Â-GAAGTAGGTGGAGT ATTGAAT-3Â (sense) and 5Â-CAAAAAAACACAATCCT...

Ngày tải lên: 18/02/2014, 18:20

... from the salivary gland of Octopus vulgaris oct-TK-I Lys–Pro–Pro–Ser–Ser–Ser–Glu–Phe–Ile–Gly–Leu–Met–NH 2 oct-TK-II Lys–Pro–Pro–Ser–Ser–Ser–Glu–Phe–Val–Gly–Leu–Met–NH 2 Substance P and SP-(Arg11) Substance ... tachykinins: a review. Zool Sci 5, 53 3–5 49. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykini...

Ngày tải lên: 19/02/2014, 00:20

... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... experi- ment carried out without the mimic, ascorbate, and ferrous sulfate was known as the control group. Biological analysis of mimics against mitochondrial damage Mitochondrial swelling w...

Ngày tải lên: 19/02/2014, 02:20

... strains have already been isolated and characterized [12,13], mainly from Pseudomonas aeruginosa strains [21,37–43]. The carbo- hydrate backbone of the so-called inner core region of Pseudomonas ... Thomas-Oates, J.E. & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strain...

Ngày tải lên: 19/02/2014, 13:20

... A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid in Bordetella sp. ... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the...

Ngày tải lên: 19/02/2014, 16:20

... among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans (formerly known as A. oxydans). ... involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 Calin B. Chiribau 1 , Cristinel Sandu 1 , Marco Fraaije...

Ngày tải lên: 19/02/2014, 16:20

... insufficient study in Chinese relation extraction drives us to investigate how to find an approach that is particularly appropriate for Chinese. 3 A Chinese Relation Extraction Model Due to the aforementioned ... Ohio, USA, June 2008. c 2008 Association for Computational Linguistics A Novel Feature-based Approach to Chinese Entity Relation Extraction Wen...

Ngày tải lên: 20/02/2014, 09:20

... helicase activity is defined as the amount of enzyme that unwinds 30% of the DNA helicase substrate at 37 °Cin30min(1 %in one min). For examining the effect of DNA- interacting compounds on DNA unwinding ... silver staining of the gel with Bio-Rad kit. 1736 T N. Phan et al. (Eur. J. Biochem. 270) Ó FEBS 2003 A novel nuclear DNA helicase with high specific...

Ngày tải lên: 20/02/2014, 11:20

... DDBJ/EMBL/GenBank databases under accession number AB081457. Intron 1 CGACAGgtgagt)3069 bpÀcaacagGTATAT Intron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)469 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)119 ... 5Â-AI (A/ C)GIATG (A/ C)GIACIGTIA CIAA(T/C)TA(T/C)TT-3Â (I represents an inosine residue) and 5Â-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TA CAT-3Â, corresponding to amino-acid...

Ngày tải lên: 21/02/2014, 03:20

... The Authors Journal compilation ª 2011 FEBS A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis Jaclyn ... that the V-type inhibition produced with glutamate as the substrate results from disruption of subunit interactions necessary...

Ngày tải lên: 05/03/2014, 23:20

... epitopes and signaling mechanisms that control tumor cell and cardiomyocyte viability, but also to exploit this epitope as a novel potential thera- peutic target to mitigate anti -ErbB2- associated cardio- toxicity ... ELISAs [11], all of the available mAbs against ErbB2, such as Herceptin (trastuzumab), 2c4 (pertuzumab), 7c2, and MAB74, recognize different epitopes from that of EDIAs....

Ngày tải lên: 06/03/2014, 00:21

... that differs from that of the eukaryotic l-arginine:glycine amidinotransferases. Abbreviations AGAT, human L-arginine:glycine amidinotransferase; AmtA, L-arginine:lysine amidinotransferase; ANS, ... ANS, 8-anilino-naphthalene-1-sulfonate; StrB, L-arginine:inosamine phosphate amidinotransferase; StrB1, Streptomyces griseus L-arginine:inosamine phosphate amidinotransferase. 3844 FEBS J...

Ngày tải lên: 06/03/2014, 22:21

... CGATTACGCCTCTGTGATTC Moc2 tagging primers Moc2- W CGTGGTTTAGATATTCCC Moc2- X GGGGATCCGTCGACCTGCAGCGTACGA CCACCA GGATTGAGCAC Moc2- Y GTTTAAACGAGCTCGAATTCATCGATGGGTTAC GTGCATCTGTG Moc2- Z CATGAGCTCAAAGCCTG Moc3 tagging ... TCT CCCGGGCATGGTTTATTCTCCTATGTC moc1–R–SalI TAT GTCGACTCACCGACGTTGTGTATCTAC moc2 R–SalI TTTA GTCGACTTACCACCAGGATTGAGCAC moc3–R–SalI CCA GTCGACTGACTGTCGTACCGTAATTCG moc...

Ngày tải lên: 23/03/2014, 05:22

... potential use of the novel β-glucan purified from P. polymyxa JB115 as an immunostimulant or as an adjuvant of some animal vaccines. β-glucan-induced nitric oxide production 167 Fig. 5. β-glucan ... Park SC. Polysaccharides isolated from Phellinus baumii stimulate murine splenocyte proliferation and inhibit the lipopoly- saccharide-induced nitric oxide production in...

Ngày tải lên: 07/08/2014, 23:22