Báo cáo khoa học: "Variable number tandem repeat analysis of Mycobacterium bovis isolates from Gyeonggi-do, Korea" ppt

... Barrett and C. Robinson Mutagenesis of TatABC FEBS Journal 272 (2005) 22612275 ê 2005 FEBS 2267 Evidence for interactions between domains of TatA and TatB from mutagenesis of the TatABC subunits of ... using all of the TatC mutants; in each case the TatABC subunits were present at similar levels and in A B Fig. 6. Effects of mutations in...

Ngày tải lên: 19/02/2014, 17:20

... Aarden, L.A., Taylor, Ó FEBS 2003 Cloning and analysis of IL-10 in fish (Eur. J. Biochem. 270) 4653 Cloning, characterization and expression analysis of interleukin-10 from the common carp, Cyprinus ... time-periods of LPS incubation and the relative expression of the carp IL-10 gene on the y-axis. Controls for 0, 1, 3 and 6 h of incubation with...

Ngày tải lên: 20/02/2014, 02:21

... pellet of these mutants also lacked FLS activity up to 1 mgặmL )1 protein. 4140 F. Wellmann et al. (Eur. J. Biochem. 269) Ó FEBS 2002 Functional expression and mutational analysis of flavonol synthase from Citrus ... evolved from a common ancestral gene, and the essence of most of the conserved amino acids has been further substantiated by site-directed mutagen...

Ngày tải lên: 21/02/2014, 03:20

... Journal compilation ê 2008 FEBS 783 Improving thermostability and catalytic activity of pyranose 2-oxidase from Trametes multicolor by rational and semi -rational design Oliver Spadiut 1 , Christian ... Trametes multicolor and Peniophora gigan- tea comprises the best studied enzyme, both from a biochemical and structural point of view [3–6]. Native...

Ngày tải lên: 07/03/2014, 03:20

... M 55 35 18 kDa kDa 0801TH - 0801TH siH -1 p epcS 08 01 T H -0801TH s i H -1 p e p cS 0 8 0 1T H -080 1 TH siH-1pepcS A Lane 1 2 3 4 5 6 7 8 9 10 11 12 Fig. 1. Molecular forms of Scpep1. (A) Analysis of molecular ... 62 amino acids, and thus may exceed the preset mass range of the MS analysis [29]. 13 16 17 18 19 14 15 α-Ctsa α-Ctsa α-Scpep1 α-Scpep1 F2 WT F2...

Ngày tải lên: 07/03/2014, 03:20

... IFW AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S. 112 Nicotiana AYA.N S-Q.AA NL HGQ AE GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... cloned and characterized Cyn d 24 as a novel pathogenesis-related protein from BGP. Additionally, the identification of Cyn d 24 has identified the inv...

Ngày tải lên: 07/03/2014, 12:20

... compilation ê 2005 FEBS 285 Computer-assisted mass spectrometric analysis of naturally occurring and artificially introduced cross-links in proteins and protein complexes Leo J. de Koning 1 , Piotr T. Kasper 1 , ... cross-linking and mass spectro- metry for mapping three-dimensional structures of proteins and protein complexes. J Mass Spectrom 38...

Ngày tải lên: 07/03/2014, 12:20

... Bugaytsova and E. B. Lindstro ă m(Eur. J. Biochem. 271) Ó FEBS 2003 Localization, purification and properties of a tetrathionate hydrolase from Acidithiobacillus caldus Zhanna Bugaytsova* and ... was satisfactory and that the tetrathionate hydrolase is a periplasmic enzyme. Purification of the tetrathionate hydrolase from tetrathionate- grown A. c...

Ngày tải lên: 07/03/2014, 14:20

... insect-toxin isolated from the venom of the Mexican scorpion Anuroctonus phaiodactylus Norma A. Valdez-Cruz 1 , Cesar V. F. Batista 1 , Fernando Z. Zamudio 1 , Frank Bosmans 2 , Jan Tytgat 2 and Lourival ... and mammalian Na + channels. Accordingly, they are divided into classical a- toxins that are highly active in mammalian brain, a- toxins that are very active in i...

Ngày tải lên: 07/03/2014, 16:20

... such time-series experimental data containing (partially) cor- rect dynamic pattern changes then we can infer the (partial) interaction structure of the underlying cellular network by integrating the analysis ... the experimental data profiles. There have been diverse approaches to identify (or reverse engineer) the functional interaction structure of a c...

Ngày tải lên: 07/03/2014, 21:20

... context-based machine translation evaluation. Machine Translation, 17(1):43–75. Masaki Murata, Kiyotaka Uchimoto, Qing Ma, Toshiyuki Kanamaru, and Hitoshi Isahara. 2005. Analysis of machine translation ... BLAST, 1 a graphical tool for performing human error analysis, from any MT system and for any language pair. BLAST has a graphical user interface, and is designe...

Ngày tải lên: 07/03/2014, 22:20

... classification of chemical compound names are important aspects of the tasks of BioNLP. This paper introduces the architecture of a system for the syntac- tic and semantic analysis of such names. Our system ... a number of different names and name types for one chemical compound, namely several systematic, semi-systematic, trivial and trade names. For ex- ample...

Ngày tải lên: 08/03/2014, 01:20

... [16]. Ó FEBS 2003 Cysteine residues in leishmanial MAT (Eur. J. Biochem. 270)31 Leishmania donovani methionine adenosyltransferase Role of cysteine residues in the recombinant enzyme Yolanda Pe ´ rez-Pertejo 1 , ... domain of each subunit, in the interface between the two dimers compri- sing the tetrameric structure [29]. This domain contains five cyst...

Ngày tải lên: 08/03/2014, 08:20

... 64–77. Academic Press, Inc., San Diego, CA, USA. 1398 L. Brecker et al. (Eur. J. Biochem. 270) Ó FEBS 2003 In situ proton NMR analysis of a-alkynoate biotransformations From ‘invisible’ substrates ... and analysis of the fermentation time courses [11–15]. While, except in propynoate, the triple bond in a-alkynoates do not carry a proton, the substrates are Ôinvisible...

Ngày tải lên: 08/03/2014, 08:20

... VNTR profiles of the M. bovis isolates in the region of Gyeonggi-do The VNTR profiles of the 59 M. bovis isolates were examined. Twelve genotypes were identified from the M. bovis isolates ... raycho@yuhs.ac † These authors contributed equally to this work. Variable number tandem repeat analysis of Mycobacterium bovis isolates from Gyeonggi-do, Korea...

Ngày tải lên: 07/08/2014, 20:23