Báo cáo khoa học: " Livelihood Strtategies of Peri-Urban Households in Response to Rural Urban Linkages: A Case Study in a Peri-Urban Area of Hanoi, Vietnam" ppt
... Journal of Science and Development April 2008: 17-30 HANOI UNIVERSITY OF AGRICULTURE Livelihood Strtategies of Peri -Urban Households in Response to Rural - Urban Linkages: A Case Study in a Peri -Urban ... livelihood assets including natural capital, human capital, physical capital, financial capital and social capital. Those households who h...
Ngày tải lên: 06/08/2014, 19:20
... and Manca Kenig for cloning and isolating the recombinant proteins. We also are grateful to Sabina Rabzelj and Sas ˇ a Jenko Kokalj for performing certain SEC experiments and for activity measurements. ... domain is cap- able of domain swapping and forms a dimer as revealed by crystal structure analysis [36]. In our case, SEC data collected for samples at pH 7 have confirmed that co...
Ngày tải lên: 19/02/2014, 06:20
... 177 A AO55930 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 ZP_00124054 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 BAC99079 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA ... water-bonded intermediate. In contrast, serine and thiol protease and amidase are confined to interacting with planar sub- strates and tetrahedral intermediat...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: Light-harvesting complex II protein CP29 binds to photosystem I of Chlamydomonas reinhardtii under State 2 conditions doc
... novo, gaining initial two- dimensional class averages and then iterative refinement fol- lowed in order to obtain improved class averages. Standard molecular modelling programs were used to visualize ... reinhardtii light-harvesting proteins. Eukaryot Cell 2, 978–994. 26 Tokutsu R, Teramoto H, Takahashi Y, Ono TA & Minagawa J (2004) The light-harvesting complex of photosystem I in...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: Chronic high-dose morphine treatment promotes SH-SY5Y cell apoptosis via c-Jun N-terminal kinase-mediated activation of mitochondria-dependent pathway pdf
... cytochrome c release and caspase-3 activation. SP600125, small interfering RNA (siRNA) against JNK and NAC attenuated morphine-induced apoptosis Accumulating evidence shows that activation of ... purchased from Qinghai Pharmaceutical General Factory (Qinghai, China). SRB, DCFH 2 -DA, naloxone, HE, NAC, ALP, DPI, CsA, the annexin V–FITC ⁄ PI apoptosis detection kit and antibody against b -ac...
Ngày tải lên: 16/03/2014, 01:20
Báo cáo khoa học: Lipid droplet and milk lipid globule membrane associated placental protein 17b (PP17b) is involved in apoptotic and differentiation processes of human epithelial cervical carcinoma cells pptx
... carcinomas. HeLa cells and human milk are stained with anti-PP17 antibody. (A) In invasive squamous cervical carcinoma, tumour cells have punctuated, ring-like cytoplasmic PP17 staining (immunohistochemistry, ... haema- toxylin counterstain). (B) Lipid-loaded HeLa cells have dominantly granular PP17 staining (immunocytochemistry, haematoxylin count- erstain). (C) Compared to controls (D)...
Ngày tải lên: 23/03/2014, 21:20
Báo cáo khoa học: "Self-Organizing Markov Models and Their Application to Part-of-Speech Tagging" potx
... are practical prob- lems we face when we try to apply the algorithms to language learning problems. One of the main obsta- cles is the fact that features used for language learn- ing often have ... Estimated Performance of Various Models man readable and we are planning to develop editing tools for self-organizing Markov models that help experts to put human knowledge about langua...
Ngày tải lên: 31/03/2014, 03:20
Báo cáo khoa học: "Physical damage on tropical tree saplings: quantification and consequences for competition through height growth in a neotropical rain forest of French Guiana" pdf
... Physical damage is the mechanical breakage of a stem by an animal (due to tramping, scraping, push- ing, biting or boring for example) or by material falling from a higher ... ecological temperment of a species influence the frequency of damage to saplings? 2) For a given individual of a given species, is physical damage automatically...
Ngày tải lên: 08/08/2014, 23:22
Tài liệu Báo cáo khoa học: The heat shock factor family and adaptation to proteotoxic stress pdf
... Nakamura T, Takaki E, Hayashida N, Hai T & Nakai A (2007) Heat shock transcription factor 1 opens chromatin structure of interleukin-6 promoter to facilitate binding of an activator or a ... reagents, 17-allylamino-17-demethoxygeldanamycin (17-AAG) and geranylgeranylacetone (GGA), also ameliorated disease progression in a Drosophila model of spinocerebellar ataxias [101] o...
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: Mouse recombinant protein C variants with enhanced membrane affinity and hyper-anticoagulant activity in mouse plasma pptx
... variants with improved membrane binding characteristics and hyper- anticoagulant activity. Binding ability was established using a SPR membrane binding assay and anticoagu- lant activity was assessed ... end point assay, the anticoagulant potency of human APC variant QGNSEDY in human plasma parallels that of mouse APC mutant III in mouse plasma. Mutant III, although only containing...
Ngày tải lên: 18/02/2014, 06:20