... 2005;106: 40 6a. 27. Oka Y, Tsuboi A, Murakami M, Hirai M, Tominaga N, Nakajima H, Elisseeva OA, Masuda T, Nakano A, Kawakami M, Oji Y, Ikegame K, Hosen N, Udaka K, Yasukawa M, Ogawa H, Kawase I, ... Transplantation, Niigata University Medical and Dental General Hospital, Niigata, Japan 3. Division of Hematology, Graduate School of Medical and Dental Sciences, Niigata University, Niiga...
Ngày tải lên: 26/10/2012, 09:39
... ﻡﺎﻴﻘﻟﺍ • iv Education for a New Era A research brief: A New System for K–12 Education in Qatar. is document is available in English as RAND RB-9248-QATAR and in Arabic as RAND RB-9248/1-QATAR. All three ... reform as it moves forward: Build more local capacity to manage the reform. Increased expertise is needed in Qatar’s teaching workforce and among the Institute staff. Non-Qat...
Ngày tải lên: 18/02/2014, 01:20
Research Program of the Partnership for a New Generation of Vehicles doc
... Laboratory, Lawrence Berkeley National Laboratory, Sandia National Laboratories, Los Alamos National Laboratory, National Renewable Energy Laboratory, Argonne National Laboratory, Oak Ridge National ... OFFUTT, Program Officer SUSANNA CLARENDON, Financial Associate PANOLA GOLSON, Project Assistant ANA-MARIA IGNAT, Project Assistant SHANNA LIBERMAN, Project Assistant 1 NAE = National Academy...
Ngày tải lên: 06/03/2014, 15:20
Báo cáo khoa học: "From route descriptions to sketches: a model for a text-to-image translator" doc
... Intelligence Laboratory, Cambridge, MA. A. Yamada, T. Yamamoto, H. Ikeda, T. Nishida, and S. Doshita. 1992. Reconstructing spatial image from natural language texts. In Proc. of COLING-9P, pages 1279-1283, ... spatial descriptions and 3-dimensional sketches (Yamada et al., 1992; Arnold and Lebrun, 1992), 2-dimensional spatial scenes and linguistic de- scriptions (Andr~ et al., 1987), 2...
Ngày tải lên: 08/03/2014, 07:20
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
... NSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA 53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ 63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEK 73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD motif- TEQGGGGAGGSNSSGS...
Ngày tải lên: 20/06/2014, 01:20
báo cáo hóa học:" A reliable measure of frailty for a community dwelling older population" doc
... extracted from the BWHHS database and recoded into binary categorical variables. This model derived from the BWHHS data was repli- cated using data from the “usual care” arm of a large Kamaruzzaman ... proposeafrailtymodeldevel- oped from factor analysis (FA), a rob ust analytical tech- nique which uses latent variables as a means of data reduction to represent a wide range of attribu...
Ngày tải lên: 20/06/2014, 15:20
Báo cáo hóa học: " ADAM: A Realistic Implementation for a W-CDMA Smart Antenna" docx
... Implementation for a W-CDMA Smart Antenna 1385 If capabilities of phased array, switched-beam array, and adaptive array antennas are compared, the last type shows considerable advantages over ... Pois- son random variable with a mean value of 25 [29]. Each user transmits only one data channel, with a spreading factor of 64. ADAM: A Realistic Implementation for a W-CDMA Smart Ant...
Ngày tải lên: 23/06/2014, 01:20
12 Step Autoresponder Sequence Yours For The Taking! By Jason Fladlien doc
... I'd start to freak out and have a panic attack. I was a prisoner in my own mind, and I hated it. Then, I made my panic attacks go away by a stroke of dumb luck. I came in contact with someone ... business. And I'm glad I "paid the price" because it was worth it. And I'd do it again in a heart beat. See, I really understand the two pains we as humans mus...
Ngày tải lên: 27/06/2014, 23:20
“Village Banks (Village Savings and Credit Groups) in Vientiane Capital, Laos” – Roadmap Scenarios for a Sustainable Future potx
... Louang Prabang 6 SCU Thakhek Khammouane 7 SCU Houamchay Phattana Savannakhet 8 SCU Paksong Savannakhet 9 SCU Huasae Chaleunouaxe Champasak 10 SCU Thoulakhom Vientiane Prov. 11 SCU Mittaphap Vientiane ... which are defi ned as a condition for receiving a loan or as collateral for a loan either as a percentage of the loan or as a nominal amount” (Art. 2). As no loans are given by...
Ngày tải lên: 15/03/2014, 10:20
A Review of Qigong Therapy for Cancer Treatment pptx
... a compatible control is a must for examining such an alternative therapy. For any scientific study of a new therapy or treat- ment, a large amount of time and resources are needed for an accurate ... Sun and Zhao 10) from Guang-An-Men Hospital con- ducted a clinical study on various advanced cancers. Among the 123 patients (mean age = 47, 60 males and 63 females) all...
Ngày tải lên: 22/03/2014, 17:20