Báo cáo hóa học: " Datura stramonium L poisoning in a geophagous child: a case report" potx
Báo cáo hóa học: " Datura stramonium L. poisoning in a geophagous child: a case report" potx
... anemia with a hemoglobin level of 7.8 g/dl.Aspartate aminotransferase, alanine aminotransferase,creatine kinase, lactic dehydrogenase, and gamma glu-tamyl transpeptidase levels were normal. ... JaballahAbstract Datura stramonium L. (DS) is a wild-growing plant widely distributed and easily accessible. It contains a variety oftoxic anticholinergic alkaloids such as atropine, hyoscamine, ... stramonium L (DS) is a hallucinogenic plantwidely found in urban and rural areas. Toxicity fromthis plant, co ntaining tropane a lkaloids, manifests as a classic anti-cholinergic poisoning [1,2]....
- 3
- 341
- 0
Báo cáo hóa học: " Simultaneous measurements of kinematics and fMRI: compatibility assessment and case report on recovery evaluation of one stroke patient" potx
... of inserting the actual kinematics para-meter s in the generation of cortical activati on maps wasevaluated comparing the two models. A high-pass filter was automatically included in theanalysis ... 23:1524-1532.28. Lancaster JL, Rainey LH, Summerlin JL, Freitas CS, Fox PT, Evans AE,Toga AW, Mazziotta JC: Automated labeling of the human brain: A preliminary report on the development and evaluation of a ... 919Medial frontal gyrus 6 15Paracentral_Lobule_R (aal) 9 13Brodmann area 2 56Parietal_Sup _L (aal) 3 5Supp_Motor_Area_R (aal) 3Right Cerebrum 3Brodmann area 7 2Cortical and subcortical regions...
- 17
- 618
- 0
báo cáo hóa học: " Efficacy of motor imagery in post-stroke rehabilitation: a systematic review" ppt
... mean change scores than the mini-mal clinically relevant difference in the ARAT and in theFMSA respectively.The methodological quality of included randomized con-trolled trials with small ... Hos-pital of Zurich, who designed and conducted the electronic database search, Jan Kool, Martina Spiess and Cornelia Barth for critical remarks and Katharina Schlatter and Arianne Knüsel for English ... did find a significantly higher level of perform-ance in the trained as well as untrained tasks for theimagery group. The trained tasks in week three were alsoevaluated in a one-month follow-up...
- 10
- 359
- 0
báo cáo hóa học: " Secreted phospholipase A2 activity in experimental autoimmune encephalomyelitis and multiple sclerosis" potx
... the devel-opment of EAE symptoms, including correlatedmorphological changes in the spinal cord. Finally, thissame urinary assay was applied to randomly collectedurine samples from MS patients ... phospholipase A2 (sPLA2) activity and clinical dis-ease in EAE rats treated with sPLA2 inhibitor CHEC-9Figure 1Secreted phospholipase A2 (sPLA2) activity and clin-ical disease in EAE rats treated with ... compared to vehicle-injected controls. Histopathological changes in the spinal cords ofthe EAE rats correlated generally with clinical score including a significant reduction in ED-1+ cellsafter...
- 8
- 375
- 0
báo cáo hóa học:" Varicella zoster virus acute retinal necrosis following eye contusion: case report" pot
... ultrasonography werenormal. Leukocyte count, hematocrit and activated partialtromboplastin time (APTT) were normal, liver testsshowed elevated levels of alaninaminotranspherase (ALT;2.63 ukat /l) . ... no plasma cellneoplasia. In two weeks, intravenous acyclovir was followed by oralacyclovir (5 × 400 mg daily). In the right eye, large foci ofretinal atrophy with reduced inflammatory reaction ... revealed swelling of the optic disc, large ischemic mac-ular edema, superficial retinal hemorrhages, narrowing ofthe arterioles and dilatation of the venules (Figure 1A) .Fluorescein angiography...
- 5
- 266
- 0
báo cáo hóa học:" Occupationally related bilateral calcific tendonitis of Flexor carpi ulnaris: case report" pdf
... correlates with occupa-tionally related repetitive strain. Case report A 42 year old male Hospital porter presented to our out-patient clinic with bilateral wrist pain. The pain was local-ised ... occupationally related. This was treated conservatively withavoidance of aggravating movement, resting splints and anti inflammatory medication when acuteflare ups occurred. Since avoidance of ... Raynauds Esophagitis SclerodermaTelangiectasia).He was managed conservatively with avoidance of pro-vocative movement, resting splints and NSAIDS for pain-Published: 23 August 2009Journal...
- 2
- 247
- 0
báo cáo hóa học:" Charcot foot reconstruction with combined internal and external fixation: case report" pot
... thefirst metatarsal to the medial malleolus was made. Dis-section was carefully carried out, with care to maintain a full-thickness dorsal and medial flap. The naviculo cu-neiform and metatarsocuneiform ... rightfoot revealed a Charcot homolateral tarsometatarsaljoint dislocation, medial displacement of the navicular,inferior subluxation of the ta rsometatarsal joints, as wellas hypertrophic ... Stapleton JJ, Cromack DT: Combined lateral columnarthrodesis, medial plantar artery flap, and circular external fixation forCharcot midfoot collapse with chronic plantar ulceration. Adv SkinWound...
- 9
- 588
- 0
báo cáo hóa học: " N-Acetyl L-Cysteine does not protect mouse ears from " pot
... Occupational Safety and Health, C-27, 4676 Columbia Parkway, Cincinnati, OH 45226, USAFull list of author information is available at the end of the articleDavis et al. Journal of Occupational ... with normal-hearing strains (i.e. CBA/CaJ and a congenic B6 strain (B6.CAST+ahl mouse) with the Ahlallele replaced with the wild-type Castaneous strainallele). Using immunohistochemical techniques ... increased labeling for super-oxide dis-mutase, glutamyl transferase and 4-hydroxynonenal in the lateral wall and spiral ganglia of B6 mice, which variedwith age between 3 and 9 months of age....
- 5
- 239
- 0
Báo cáo hóa học: " Superhydrophobic poly(L-lactic acid) surface as potential bacterial colonization substrate" pptx
... substances (EPS). In fact, as a Gram-negative bacterium, the cell wall of P. aeruginosacontains lipids, proteins, and lipopolysaccha rides (LPS),while the cell wall of the Gram-positive bacteria, ... 10-foldserial dilutions in saline sol ution (NaCl 0.9%) and plated in TSA, in triplicate. Prior to colony enumeration, theplates were incubated for 24 h at 37°C.Bacteria removal assaysBacteria removal ... (Urayama et al. 2002). In fact, bio-degradable polymers have been receiving an increasinginterest for biomedical applications, given that bio de-gradable polymeric films have potential applicationsfor...
- 9
- 293
- 0
Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx
... ATCRSCAHCPWMAMNGLQAIAEALEQEGSN HEVHVDERLRERALVPLN 336 NADA_SALTY LLEAPTAGEG ATCRSCAHCPWMAMNGLKAIAEGLEQGGAA HEIQVDAALREGALLPLN 336 NADA_BACSU QIESLN PDMCPCLTMNRIDLPHLLWSLEQIEKGEP SGVIKVPKAIQEDALLALN 362 NADA_HELPY ... 89 NADA_SYNY3 MFTAVAPPQETLP RDLVGAIQSLKKELNAVILAHYYQEAAIQDIADYLG DSLGLSQQAASTD ADVIVFAGVHFMAETAKILNPHK 85 NADA_SYNEC MFTAVAPPQETLP RDLVGAIQSLKKELNAVILAHYYQEAAIQDIADYLG DSLGLSQQAASTD ADVIVFAGVHFMAETAKILNPHK ... NADA_MYCLE NVYVWMGECHVHAGINGDELVDQARANPDAELFVHPECGCSTSALYLAGEGAFPPDRVKILSTGGMLTAAR QTQY-RKILVATEVGMLYQLRRAAPEID 293 NADA_MYCTU NLHVWAGECHVHAGINGDELADQARAHPDAELFVHPECGCATSALYLAGEGAFPAERVKILSTGGMLEAAH...
- 18
- 350
- 0
Từ khóa: báo cáo khoa họcbáo cáo môn học hóa dầubáo cáo trường học văn hóa năm 2012báo cáo trường học văn hóaquảng cáo trên báo giấy hoa học tròchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngThơ nôm tứ tuyệt trào phúng hồ xuân hươngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015MÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ