... lL of the cell suspension of each well were transferred into another 96-well plate containing 200 lLof2· LB amp ⁄ lactose (yeast extract 10 g L )1 , peptone from casein 20 g L )1 , sodium chloride ... resulting from the oxida- tion of the sugar, at the active site of the enzyme and transfer these to the electrode. In a biofuel cell based on an enzyme that is electr...
Ngày tải lên: 07/03/2014, 03:20
... RSDM calculation. The homogeneity of the values of the overall correlation time calculated from the individual (R 2 ⁄ R 1 ) ratios suggested a good degree of isotropy of the global molecular motion, ... J(<x H >), directly calculated from the measured relaxation parameters, that contain contribu- tions from the overall as well as the local dynamics. Graphic...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Molecular modeling and functional characterization of the monomeric primase–polymerase domain from the Sulfolobus solfataricus plasmid pIT3 doc
... plasmid pRN1 [13] reveal that the novel fold in the N-terminal mod- ules of the catalytic cores of AEPs and prim–pols is unrelated to that of other known polymerases, whereas the RRM-like fold ... both these primases and the associated heli- cases are the constituent elements of the replication initiation complex of the corresponding plasmids [12]. Available stru...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: Design, structure and biological activity of b-turn peptides of CD2 protein for inhibition of T-cell adhesion ppt
... adhesion and costimulation in the normal immune response. The CD2 molecule is a transmembrane glycoprotein expressed on all subsets of T-cells, NK cells and lymphokine-activated killer cells, all known ... (2000) Linear and cyclic LFA-1 and ICAM-1 pep- tides inhibit T cell adhesion and function. Peptides 21, 1161– 1167. Supplementary material The following material is availa...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: Molecular characterization and allergenic activity of Lyc e 2 (b-fructofuranosidase), a glycosylated allergen of tomato pdf
... structures. The structures of the N-glycans of nLyc e 2 and their molecular percentages are presentec in Table 2. The peptide analysis of nLyc e 2 identified 21 peptides of the natural allergen. One of ... identify and characterize tomato allergens. In most reports, allergy to tomato is linked to other allergies such as grass pollen [1] and latex allergy [2,3]. The pr...
Ngày tải lên: 21/02/2014, 00:20
Tài liệu Báo cáo khoa học: Physicochemical characterization and biological activity of a glycoglycerolipid from Mycoplasma fermentans ppt
... potential involvement of TLR2 and TLR4 in the recognition and signal transduction of the glycolipids, we analyzed the stimulatory activity of MfGl-II in a CHO cell reporter system. Upon the induction ... on the property of lysates of amebocytes of the horseshoe crab Limulus polyphemus,to form a solid gel in the presence of minute amounts of endotoxins. The...
Ngày tải lên: 21/02/2014, 00:20
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot
... STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLA 44 Hordeum MQTPKLVILLALAMSAAMVNLSQAQNSP YVSP AA AVG.GAVS.S.K.Q 54 Triticum MQTPKLAILLALAMSAAMANLSQAQNSP Y.SP AA AVG.GAV S.K.Q 54 Zea MAPRLACLLALAMAAIVVAPCTAQNSP ... Characterization of the isoforms of the group I allergen of Cynodon dactylon. J Allergy Clin Immunol 95, 1206–1214. 8 Smith PM, Sulphilglu C, Griffith IJ, Theriault K, Knox...
Ngày tải lên: 07/03/2014, 12:20
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf
... & Walsh, D.A. (1997) Specific tes- ticular cellular localization and hormonal regulation of the PKI and PKI isoforms of the inhibitor protein of the cAMP-dependent protein kinase. J. Biol. Chem. ... the cells; C, 5 lLofheat- treated crude extract; D, 5 lLof(NH 4 ) 2 SO 4 fractionation; E, 5 lLof DEAEeluate;F,10lL of DEAE eluate. Fractions were analyzed by SDS/PAGE (12%)...
Ngày tải lên: 07/03/2014, 15:20
Báo cáo khoa học: Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B docx
... Because of the known dependence of the overall correlation time s c on the molecular size of various proteins [23], both s c values of the XPCB are well matched to those of spherical molecules of ... functional domain. A number of other cellular proteins exist that, like hHR23B, con- tain the STI1, UBL and UBA domains connected by relatively flexible linkers. It is li...
Ngày tải lên: 07/03/2014, 17:20
Báo cáo khoa học: Molecular cloning and functional expression of the human sodium channel b1B subunit, a novel splicing variant of the b1 subunit potx
... tissues. (A) The presence of b 1B in Purkinje cells (large arrowheads) and in their processes (small arrowheads) of the cerebellum. (B) Specific b 1B labeling was abolished in the Purkinje cells (arrowhead) ... placenta, lung, liver, kidney and pancreas. In human brain, the b 1B transcript was most abundant in the cerebellum, followed by the cerebral cortex and occipital...
Ngày tải lên: 16/03/2014, 23:20